Property Summary

NCBI Gene PubMed Count 32
Grant Count 115
R01 Count 76
Funding $12,516,121.16
PubMed Score 114.68
PubTator Score 28.24

Knowledge Summary

Patent

No data available

Expression

Gene

PANTHER Protein Class (2)

Gene RIF (18)

PMID Text
24591081 PCDH11X, expressed in brain is implicated in cell-cell communication, verbal ability, cerebral asymmetry, and dendritic synaptic plasticity, may be regarded as a new candidate gene for dyslexia.
23600975 the PCDH11X/Y gene pair determines cerebral asymmetry by initiating the right shift in Homo sapiens
22744706 PCDH11X expression was detected in the fetal neocortex, ganglionic eminences, cerebellum, and inferior olive. In the adult brain, the cerebral cortex, hippocampal formation, and cerebellum and brain stem were immunoreactive.
21276771 our data...failed to confirm the association between PCDH11X polymorphisms and late-onset Alzheimer's disease
20707987 PCDH11X gene polymorphism does not play a major role in the genetic predisposition to late-onset Alzheimer disease in this Han Chinese population.
20707987 Observational study of gene-disease association. (HuGE Navigator)
20574532 Observational study of gene-disease association. (HuGE Navigator)
20555150 association not found for rs5984894 polymorphism in PCDH11X in Alzheimer's disease in Italy
20555150 Observational study of gene-disease association. (HuGE Navigator)
20523261 An association between late-onset Alzheimer disease and the PCDH11X polymorphisms, was not detected.
More...

AA Sequence

MDLLSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTG      1 - 70
DVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFP     71 - 140
ATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDRE    141 - 210
EKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE    211 - 280
NAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVND    281 - 350
NVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLET    351 - 420
AAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSA    421 - 490
MDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSI    491 - 560
IDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNIS    561 - 630
FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIA    631 - 700
VDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNL    701 - 770
FVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAP    771 - 840
HLKAAQKNKQNSEWATPNPENRQMIMMKKKKKKKKHSPKNLLLNFVTIEETKADDVDSDGNRVTLDLPID    841 - 910
LEEQTMGKYNWVTTPTTFKPDSPDLARHYKSASPQPAFQIQPETPLNSKHHIIQELPLDNTFVACDSISK    911 - 980
CSSSSSDPYSVSDCGYPVTTFEVPVSVHTRPPMKEVVRSCTPMKESTTMEIWIHPQPQRKSEGKVAGKSQ    981 - 1050
RRVTFHLPEGSQESSSDGGLGDHDAGSLTSTSHGLPLGYPQEEYFDRATPSNRTEGDGNSDPESTFIPGL   1051 - 1120
KKAAEITVQPTVEEASDNCTQECLIYGHSDACWMPASLDHSSSSQAQASALCHSPPLSQASTQHHSPRVT   1121 - 1190
QTIALCHSPPVTQTIALCHSPPPIQVSALHHSPPLVQATALHHSPPSAQASALCYSPPLAQAAAISHSSP   1191 - 1260
LPQVIALHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFTPRQ   1261 - 1330
QARPSRGDSPIMEEHPL                                                        1331 - 1347
//

Text Mined References (33)

PMID Year Title
24591081 2013 Genome-wide copy number scan identifies disruption of PCDH11X in developmental dyslexia.
23600975 2013 The protocadherin 11X/Y (PCDH11X/Y) gene pair as determinant of cerebral asymmetry in modern Homo sapiens.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
22744706 2013 Protocadherin 11X/Y a human-specific gene pair: an immunohistochemical survey of fetal and adult brains.
21276771 2011 Lack of association between protocadherin 11-X/Y (PCDH11X and PCDH11Y) polymorphisms and late onset Alzheimer's disease.
20707987 2010 Lack of association between PCDH11X genetic variation and late-onset Alzheimer's disease in a Han Chinese population.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20555150 2010 Failure to replicate an association of rs5984894 SNP in the PCDH11X gene in a collection of 1,222 Alzheimer's disease affected patients.
20523261 2010 PCDH11X variation is not associated with late-onset Alzheimer disease susceptibility.
More...