Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BZA5
Symbols TXLNG2P
CYorf15A
CYorf15B

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPVHCTQESRREL      1 - 70
PEQEVAPPSGQQALQCNRNKEKVLGKEVLLLMQALNTLSTPEEKLAALCKKYADLGNSPLL              71 - 131
//

Text Mined References (10)

PMID Year Title