Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZA5
Symbols TXLNG2P
CYorf15A
CYorf15B

Gene

 Compartment GO Term (0)

AA Sequence

MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPVHCTQESRREL      1 - 70
PEQEVAPPSGQQALQCNRNKEKVLGKEVLLLMQALNTLSTPEEKLAALCKKYADLGNSPLL              71 - 131
//

Text Mined References (10)

PMID Year Title
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16136134 2005 Conservation of Y-linked genes during human evolution revealed by comparative sequencing in chimpanzee.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
9847074 1998 Toward a complete human genome sequence.