Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.81053212549045E-4
non diabetic and post-ischemic heart failure 200 0.0103744453178626

Synonym

Accession Q9BZA0
Symbols TTY10
NCRNA00133

Gene

 Compartment GO Term (0)

AA Sequence

MKLQTLMDWEEAHEKNRKNKRKAEALVAALQTCRVQDPPGTSTDCYLLPVLKPGHFKKNCPSHKKKPP        1 - 68
//

Text Mined References (1)

PMID Year Title
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.