Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q9BZA0
Symbols TTY10
NCRNA00133

Gene

 Compartment GO Term (0)

AA Sequence

MKLQTLMDWEEAHEKNRKNKRKAEALVAALQTCRVQDPPGTSTDCYLLPVLKPGHFKKNCPSHKKKPP        1 - 68
//

Text Mined References (2)

PMID Year Title