Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZ98
Symbols TTY11
TTY12
NCRNA00135

Gene

 Compartment GO Term (0)

AA Sequence

MIDPETRHKAFLKAWPWQNSTITFVPGLAICHYSSVQVPRRGAILPMLYALCYVKMPSFQHGPGRMYHLT      1 - 70
CDWPRKMSLSCHVCRAHFRD                                                       71 - 90
//

Text Mined References (1)

PMID Year Title
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.