Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 3.711 1.9

Synonym

Accession Q9BZ97
Symbols TTY13
NCRNA00136

Gene

 Compartment GO Term (0)

AA Sequence

MKTQDDGVLPPYDVNQLLGWDLNLSLFLGLCLMLLLAGSCLPSPGITGLSHGSNREDR                  1 - 58
//

Text Mined References (1)

PMID Year Title
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.