Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.15
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Hereditary spherocytosis type 1 23 3.653 1.8

Synonym

Accession Q9BZ81
Symbols CT3.3
MAGE-B5

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (1)

AA Sequence

MTSAGVFNAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLYKFKMKQRILKEDMLKIV      1 - 70
NPRYQNQFAEIHRRASEHIEVVFAVDLKEVNPTCHLYDLVSKLKLPNNGRIHVGKVLPKTGLLMTFLVVI     71 - 140
FLKGNCANKEDTWKFLDMMQIYDGKKYYIYGEPRKLITQDFVRLTYLEYHQVPCSYPAHYQFLWGPRAYT    141 - 210
ETSKMKVLEYLAKVNDIAPGAFSSQYEEALQDEEESPSQRCSRNWHYCSGQDCLRAKFSSFSQPY         211 - 275
//

Text Mined References (2)

PMID Year Title