Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.82
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZ81
Symbols CT3.3
MAGE-B5

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MTSAGVFNAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLYKFKMKQRILKEDMLKIV      1 - 70
NPRYQNQFAEIHRRASEHIEVVFAVDLKEVNPTCHLYDLVSKLKLPNNGRIHVGKVLPKTGLLMTFLVVI     71 - 140
FLKGNCANKEDTWKFLDMMQIYDGKKYYIYGEPRKLITQDFVRLTYLEYHQVPCSYPAHYQFLWGPRAYT    141 - 210
ETSKMKVLEYLAKVNDIAPGAFSSQYEEALQDEEESPSQRCSRNWHYCSGQDCLRAKFSSFSQPY         211 - 275
//

Text Mined References (2)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
10861452 2000 MAGE-B5, MAGE-B6, MAGE-C2, and MAGE-C3: four new members of the MAGE family with tumor-specific expression.