Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.20

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZ68 A1A4X4
Symbols

Gene

 GO Component (1)

 Compartment GO Term (1)

Protein-protein Interaction (2)

AA Sequence

MDGTEGSVGQPGPTERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLRAHELHCAVREVLKLPDI      1 - 70
ALDVFALWLVSPLLEVQLKPKNQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKGRELQIP     71 - 140
DEEVLRLLYEEAKGNVLAARYLCDVEDCEALGALVCRVQLVTYQPDWPAACDLREKLDSFLPAHLCKRGQ    141 - 210
GLFAALRGRGARAGPGEQSLLNAYRKVQEVSSDGGCEAALGTHYRAYLLKCHKLPFYGCAFFHGEVDKPA    211 - 280
QGFLHRGGRKSVSVAISLEGVHVVDSREKHVLLGLCFQELSWDHTSPEEEEPILWLEFDRDSGVTPVNKL    281 - 350
LKIYSKQAELMSSLIEYCI                                                       351 - 369
//

Text Mined References (2)

PMID Year Title