Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.212 1.6e-07
Astrocytoma, Pilocytic 1.200 4.7e-06
breast carcinoma 1.400 2.9e-03
glioblastoma multiforme 1.100 7.2e-18
juvenile dermatomyositis 1.050 1.7e-13
osteosarcoma 1.837 1.2e-08
ovarian cancer 1.400 4.1e-03
primary pancreatic ductal adenocarcinoma 1.024 1.5e-02

Synonym

Accession Q9BZ67 B4E2P1 Q86V56 Q8NCB5
Symbols FKSG44

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDI      1 - 70
ALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIH     71 - 140
DEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQ    141 - 210
SLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPA    211 - 280
QGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKL    281 - 350
LKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTI    351 - 420
DYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQG                              421 - 464
//

Text Mined References (13)

PMID Year Title