Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.21
PubTator Score 8.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.088 2.2e-02
adult high grade glioma -2.600 5.9e-06
astrocytic glioma -2.100 2.0e-02
atypical teratoid / rhabdoid tumor -2.400 1.5e-07
dermatomyositis 1.300 3.1e-03
ependymoma -1.700 6.9e-03
esophageal adenocarcinoma -1.700 2.6e-02
glioblastoma -1.700 1.9e-05
group 4 medulloblastoma -2.300 8.9e-05
interstitial lung disease -1.100 3.2e-02
juvenile dermatomyositis 1.169 2.5e-09
lung adenocarcinoma -1.300 2.6e-15
lung cancer -2.800 4.8e-04
malignant mesothelioma -1.200 1.3e-04
medulloblastoma, large-cell -1.500 2.4e-03
mucosa-associated lymphoid tissue lympho... 1.262 2.2e-02
non-small cell lung cancer -1.380 8.3e-15
oligodendroglioma -1.500 2.0e-02
primitive neuroectodermal tumor -1.300 1.5e-04
psoriasis 1.100 2.2e-03
sarcoidosis -1.100 4.8e-03
spina bifida -1.904 2.3e-02
subependymal giant cell astrocytoma -2.710 3.2e-02

Gene RIF (10)

AA Sequence

MSQPPLLPASAETRKFTRALSKPGTAAELRQSVSEVVRGSVLLAKPKLIEPLDYENVIVQKKTQILNDCL      1 - 70
REMLLFPYDDFQTAILRRQGRYICSTVPAKAEEEAQSLFVTECIKTYNSDWHLVNYKYEDYSGEFRQLPN     71 - 140
KVVKLDKLPVHVYEVDEEVDKDEDAASLGSQKGGITKHGWLYKGNMNSAISVTMRSFKRRFFHLIQLGDG    141 - 210
SYNLNFYKDEKISKEPKGSIFLDSCMGVVQNNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILNKIL    211 - 280
QLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDF    281 - 350
SSAEPEVKSFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIKYNRKISADFHVDL    351 - 420
NHFSVRQMLATTSPALMNGSGQSPSVLKGILHEAAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHC    421 - 490
AEPYMKSSDSSKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKNARFSAIYRQDSNKLSND    491 - 560
DMLKLLADFRKPEKMAKLPVILGNLDITIDNVSSDFPNYVNSSYIPTKQFETCSKTPITFEVEEFVPCIP    561 - 630
KHTQPYTIYTNHLYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPGGPVFTRSAFAA    631 - 700
VLHHHQNPEFYDEIKIELPTQLHEKHHLLLTFFHVSCDNSSKGSTKKRDVVETQVGYSWLPLLKDGRVVT    701 - 770
SEQHIPVSANLPSGYLGYQELGMGRHYGPEIKWVDGGKPLLKISTHLVSTVYTQDQHLHNFFQYCQKTES    771 - 840
GAQALGNELVKYLKSLHAMEGHVMIAFLPTILNQLFRVLTRATQEEVAVNVTRVIIHVVAQCHEEGLESH    841 - 910
LRSYVKYAYKAEPYVASEYKTVHEELTKSMTTILKPSADFLTSNKLLKYSWFFFDVLIKSMAQHLIENSK    911 - 980
VKLLRNQRFPASYHHAVETVVNMLMPHITQKFRDNPEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYI    981 - 1050
SCFAPGDPKTLFEYKFEFLRVVCNHEHYIPLNLPMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLR   1051 - 1120
EVGTALQEFREVRLIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPV   1121 - 1190
NAGMTVKDESLALPAVNPLVTPQKGSTLDNSLHKDLLGAISGIASPYTTSTPNINSVRNADSRGSLISTD   1191 - 1260
SGNSLPERNSEKSNSLDKHQQSSTLGNSVVRCDKLDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTSE   1261 - 1330
LMDFFTISEVCLHQFQYMGKRYIARTGMMHARLQQLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEV   1331 - 1400
CLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKNVFTALRSLIYKFPSTFYEG   1401 - 1470
RADMCAALCYEILKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGG   1471 - 1540
TRFQQSLSIINNCANSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYAST   1541 - 1610
PELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKEAVQWEPPLLPHSHSACLRRSRGGVFRQ   1611 - 1680
GCTAFRVITPNIDEEASMMEDVGMQDVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRD   1681 - 1750
FERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQAAQYQFTDSETDVEGFFEDEDGKEYIYKEP   1751 - 1820
KLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERS   1821 - 1890
HNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVA   1891 - 1960
ELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQA   1961 - 2030
LAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQLG                                  2031 - 2069
//

Text Mined References (28)

PMID Year Title