Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.29
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Mastitis 48 3.662 1.8

Synonym

Accession Q9BZ19 Q4VXE6
Symbols C20orf86
bA196N14.3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

 GWAS Trait (1)

 HCA RNA Cell Line (1)

Gene RIF (3)

AA Sequence

MTRGRAWGMRRAAAGAGGARAAGPTGGASRLHPNAGRRSGARAGAQGCGGPRVGSADSRALPAQPLACAR      1 - 70
GRSQRLVCDPKAASALPDLAPDVFVLRVRLEETGEMFRVANCRGDMTVRELKEELDLMVGIPFNLQRLQY     71 - 140
LDEGVLMDDTTLKFHDVVPGGIISLCIWHHDGWTELVLAAVEGDPSKLSCLGLTEDSFYRTANSEHFEGE    141 - 210
KWKHWTSQRAFVALYVASHRGHFDAVQYLLEHGASCLSRSPLGRTPLHVAAAMGRSDCIILLLQHGASIH    211 - 280
DRDAKGETPISIAHRLNHTLSERQMVLLHRIAKSGIRDLNDLVMKNALQRVKSGFRSEKMTMTPH         281 - 345
//

Text Mined References (4)

PMID Year Title