Property Summary

NCBI Gene PubMed Count 58
Grant Count 16
R01 Count 9
Funding $19,572,133.83
PubMed Score 122.04
PubTator Score 106.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (51)

PMID Text
26981633 This study identifies REG4 as a potential serum biomarker for histotype-specific detection of mucinous ovarian cancer and suggests serum REG4 measurement as a non-invasive diagnostic tool for follow-up of patients with mucinous ovarian cancer.
26531138 Study demonstrated that REG4, which is overexpressed in pancreatic ductal adenocarcinoma and secreted by cancer cells, promoted macrophage polarization to M2, through at least in part, activation of ERK1/2 and CREB.
26387746 REG4 is a transcriptional target of GATA6 and is essential for colorectal tumorigenesis.
26077911 aberrant REG4 expression plays an essential role in early ovarian carcinogenesis and is closely linked to mucinous ovarian tumors, differentiation and adverse prognosis of ovarian cancer by modulating proliferation, apoptosis, migration and invasion.
25338725 Colorectal tumor patients with Reg4- and MMP-7-positive tumors had extremely poor overall survival.
25295732 REG4 expression associated with favorable clinicopathological parameters and with higher overall survival from non-mucinous
25155043 High expression of REG4 is associated with poor therapeutic response, adverse outcome and an aggressive phenotype in rectal cancer patients treated with neoadjuvant chemoradiotherapy.
24886316 miR-24 functions as a novel tumor suppressor in gastric cancer, and the anti-oncogenic activity may involve its inhibition of the target gene REG4.
24151146 Reg4-induced mitogenesis involves Akt-GSK3beta-beta-Catenin-TCF-4 signaling in human colorectal cancer.
24101199 the combination of VEGF-C and Reg IV may be a promising factor for clinical staging to supplement the classical TNM classification system.
More...

AA Sequence

MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASI      1 - 70
LSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLT     71 - 140
WSSNECNKRQHFLCKYRP                                                        141 - 158
//

Text Mined References (58)

PMID Year Title
26981633 2016 REG4 Is Highly Expressed in Mucinous Ovarian Cancer: A Potential Novel Serum Biomarker.
26531138 2016 The pancreatic cancer secreted REG4 promotes macrophage polarization to M2 through EGFR/AKT/CREB pathway.
26387746 2015 REG4 is a transcriptional target of GATA6 and is essential for colorectal tumorigenesis.
26077911 2015 The role of the REG4 gene and its encoding product in ovarian epithelial carcinoma.
25338725 2015 Overexpression of Reg4, alone or combined with MMP-7 overexpression, is predictive of poor prognosis in colorectal cancer.
25295732 2014 REG4 independently predicts better prognosis in non-mucinous colorectal cancer.
25155043 2014 Overexpression of REG4 confers an independent negative prognosticator in rectal cancers receiving concurrent chemoradiotherapy.
24886316 2014 Tumor suppressor miR-24 restrains gastric cancer progression by downregulating RegIV.
24151146 2014 Reg4-induced mitogenesis involves Akt-GSK3?-?-Catenin-TCF-4 signaling in human colorectal cancer.
24101199 2013 New molecular staging with G-factors (VEGF-C and Reg IV) by supplementing TNM classification in colorectal cancers.
More...