Property Summary

NCBI Gene PubMed Count 35
PubMed Score 53.55
PubTator Score 55.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.600 2.0e-03
astrocytic glioma -1.200 4.2e-03
atypical teratoid / rhabdoid tumor -1.200 2.4e-04
glioblastoma -1.100 1.7e-04
group 3 medulloblastoma -1.400 1.1e-02
lung adenocarcinoma -1.700 8.4e-08
lung cancer -1.700 3.0e-04
lung carcinoma -1.100 1.0e-14
medulloblastoma, large-cell -1.300 3.6e-03
non-small cell lung cancer -1.110 4.7e-15
osteosarcoma -1.033 2.3e-04
primitive neuroectodermal tumor -1.200 1.0e-03
sarcoidosis -1.300 2.4e-02

Gene RIF (24)

AA Sequence

MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSR      1 - 70
DVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGC     71 - 140
QLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALIS    141 - 210
RRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFA    211 - 280
HKIYLSTSSSKFYDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCES    281 - 350
VDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSS    351 - 420
IQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRV    421 - 490
KECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYT    491 - 560
GMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADW    561 - 630
CLHHICTNYNNVCRKFPRDMKAMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRR    631 - 700
WLFWNSPSSPSSSAASSSSPSSSSAVV                                               701 - 727
//

Text Mined References (37)

PMID Year Title