Property Summary

NCBI Gene PubMed Count 33
Grant Count 12
R01 Count 10
Funding $1,072,931.91
PubMed Score 53.93
PubTator Score 55.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.200 0.004
osteosarcoma -1.033 0.000
glioblastoma -1.600 0.000
medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.300 0.006
non-small cell lung cancer -1.708 0.000
lung cancer -1.700 0.000
sarcoidosis -1.300 0.024
adult high grade glioma -1.600 0.002
lung adenocarcinoma -1.700 0.000
lung carcinoma -1.100 0.000

Gene RIF (23)

PMID Text
24608665 data suggest a new paradigm for Hsp90-modulated assembly of a Cul3/DBC2 E3 ubiquitin ligase complex that may extend to other E3 ligase complexes.
24485767 Mutation in the promoter and exon 7 of DBC2 gene is not common in the Chinese population and may not contribute to the susceptibility for breast cancer in China
24356943 ). The results demonstrated that aberrant methylation of RhoBTB2 may be responsible for the suppression of RhoBTB2 mRNA expression in breast cancer, a significant event during the genesis of breast cancer that correlated with progesterone receptor status
23546941 Thus loss of DBC2 expression is caused by abnormal methylation of DBC2 and might have a role in breast cancer development.
22901165 Loss of DBC2 expression is an early and progressive event in the development of lung adenocarcinoma.
21801820 Overexpression of RhoBTB2 in breast tumor cells significantly inhibited the proliferation and colony formation of tumor cells. In addition, RhoBTB2 also elevated the apoptotic ratio and caused typical changes of apoptotic morphology.
20980811 RhoBTB2 is establishing itself as a tumor suppressor with increasing relevance towards malignancies.
20930524 Ectopic expression of RhoBTB2 results in decreased phosphorylation of ezrin and Akt2 in both MDA-MB-231 and MDA-MB-435 cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19937980 Frequent loss of RhoBTB2 expression is associated with sporadic breast cancer.
More...

AA Sequence

MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSR      1 - 70
DVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGC     71 - 140
QLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALIS    141 - 210
RRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFA    211 - 280
HKIYLSTSSSKFYDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCES    281 - 350
VDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSS    351 - 420
IQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRV    421 - 490
KECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYT    491 - 560
GMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADW    561 - 630
CLHHICTNYNNVCRKFPRDMKAMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRR    631 - 700
WLFWNSPSSPSSSAASSSSPSSSSAVV                                               701 - 727
//

Text Mined References (34)

PMID Year Title
24608665 2014 Hsp90-dependent assembly of the DBC2/RhoBTB2-Cullin3 E3-ligase complex.
24485767 2014 The mutation of DBC2 in breast cancer patients from the Han ethnic group in Eastern China.
24356943 2014 RhoBTB2 gene in breast cancer is silenced by promoter methylation.
23546941 2013 Decreased expression of the DBC2 gene and its clinicopathological significance in breast cancer: correlation with aberrant DNA methylation.
22901165 2012 Loss of DBC2 expression is an early and progressive event in the development of lung adenocarcinoma.
21801820 2011 RhoBTB2 (DBC2) functions as tumor suppressor via inhibiting proliferation, preventing colony formation and inducing apoptosis in breast cancer cells.
20980811 2010 RhoBTB2 (DBC2) comes of age as a multifunctional tumor suppressor.
20930524 2010 Ectopic expression of RhoBTB2 inhibits migration and invasion of human breast cancer cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19937980 2010 A novel tumor suppressor gene RhoBTB2 (DBC2): frequent loss of expression in sporadic breast cancer.
More...