Property Summary

NCBI Gene PubMed Count 8
PubMed Score 50.72
PubTator Score 5.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Conjunctivochalasis 6 4.156 2.1
Trachoma 5 3.759 1.9
Hodgkin's lymphoma 15 3.662 1.8

Expression

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIERFTSEKPVHHS      1 - 70
KVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPFTKMPNIVCSKDYFVTANSNL     71 - 140
VIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHCKLIIVSNPVDILTYVAWKLSAFPKNRIIGS    141 - 210
GCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVH    211 - 280
KEVTATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHPVSTIIKGLYGIDEEVFLSIPCILGENGIT    281 - 350
NLIKIKLTPEEEAHLKKSAKTLWEIQNKLKL                                           351 - 381
//

Text Mined References (8)

PMID Year Title