Property Summary

NCBI Gene PubMed Count 8
PubMed Score 49.93
PubTator Score 5.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q9BYZ2 Q6DUY4 Q96LI2
Symbols LDHL
LDH6B
LDHAL6

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIERFTSEKPVHHS      1 - 70
KVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPFTKMPNIVCSKDYFVTANSNL     71 - 140
VIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHCKLIIVSNPVDILTYVAWKLSAFPKNRIIGS    141 - 210
GCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVH    211 - 280
KEVTATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHPVSTIIKGLYGIDEEVFLSIPCILGENGIT    281 - 350
NLIKIKLTPEEEAHLKKSAKTLWEIQNKLKL                                           351 - 381
//

Text Mined References (8)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
15870898 2005 Cloning and characterization of a novel intronless lactate dehydrogenase gene in human testis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107167 2002 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1.