Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.14
PubTator Score 0.50

Knowledge Summary

Patent

No data available

AA Sequence

MDDDTAVLVIDNGSGMCKAGFAGDDAPQAVFPSIVGRPRHQGMMEGMHQKESYVGKEAQSKRGMLTLKYP      1 - 70
MEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVL     71 - 140
SLYTSGRTTGIVMDSGDGFTHTVPIYEGNALPHATLRLDLAGRELTDYLMKILTERGYRFTTTAEQEIVR    141 - 210
DIKEKLCYVALDSEQEMAMAASSSSVEKSYELPDGQVITIGNERFRCPEALFQPCFLGMESCGIHKTTFN    211 - 280
SIVKSDVDIRKDLYTNTVLSGGTTMYPGIAHRMQKEITALAPSIMKIKIIAPPKRKYSVWVGGSILASLS    281 - 350
TFQQMWISKQEYDESGPSIVHRKCF                                                 351 - 375
//

Text Mined References (7)

PMID Year Title
23673617 2013 ALKBH4-dependent demethylation of actin regulates actomyosin dynamics.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
16824795 2006 Identification of a novel actin isoform in hepatocellular carcinoma.
16364570 2006 Duplication and extensive remodeling shaped POTE family genes encoding proteins containing ankyrin repeat and coiled coil domains.
16341674 2005 Transcriptome analysis of human gastric cancer.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
6457647 1981 Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.