Property Summary

NCBI Gene PubMed Count 205
PubMed Score 455.26
PubTator Score 345.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Primary immunodeficiency disease 54 0.0 3.0
Type 1 diabetes mellitus 109 0.0 3.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.312 1.7

Expression

  Differential Expression (21)

Disease log2 FC p
dermatomyositis 2.300 5.6e-03
psoriasis 1.500 2.8e-05
active Crohn's disease 1.221 9.0e-03
adult high grade glioma 1.300 3.4e-03
Astrocytoma, Pilocytic 1.800 3.6e-06
cutaneous lupus erythematosus 2.400 1.3e-04
cystic fibrosis 1.245 3.8e-04
ependymoma 1.900 1.1e-09
glioblastoma 1.500 1.8e-04
group 4 medulloblastoma -1.100 3.5e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.5e-02
juvenile dermatomyositis 3.433 7.2e-18
lung cancer -1.800 1.8e-04
lung carcinoma -1.600 6.2e-13
malignant mesothelioma 1.200 4.6e-06
medulloblastoma, large-cell -1.700 3.7e-05
Multiple Sclerosis 1.700 2.1e-02
nasopharyngeal carcinoma 1.500 2.0e-04
primary Sjogren syndrome 1.900 2.4e-03
Systemic lupus erythematosus 1.200 3.2e-03
tuberculosis 1.200 6.1e-03

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (192)

AA Sequence

MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGV      1 - 70
WHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCME     71 - 140
EELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIE    141 - 210
NLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNM    211 - 280
GSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKK    281 - 350
KKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS    351 - 420
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS    421 - 490
PGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTR    491 - 560
IQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFY    561 - 630
NEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEK    631 - 700
LTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNE    701 - 770
QKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV    771 - 840
IEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNC    841 - 910
SVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLP    911 - 980
CLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDED                             981 - 1025
//

Text Mined References (216)

PMID Year Title