Property Summary

NCBI Gene PubMed Count 179
Grant Count 238
R01 Count 107
Funding $30,292,817.65
PubMed Score 384.30
PubTator Score 345.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q9BYX4 Q2NKL6 Q6DC96 Q86X56 Q96MX8 Q9H3G6
Symbols AGS7
Hlcd
MDA5
MDA-5
RLR-2
IDDM19
SGMRT1

Gene

PDB

2RQB   3B6E   3GA3   4GL2  

 GO Component (2)

Gene RIF (171)

PMID Text
26782418 Our findings indicate that although STAT4 and IFIH1 SNPs are not associated with T1D in a Brazilian population, they might play a role in susceptibility to T1D on a larger worldwide scale
26646717 Using bone marrow derived macrophages from knockout mice we demonstrate that hBD3 suppresses the polyI:C-induced TLR3 response mediated by TICAM1 (TRIF), while exacerbating the cytoplasmic response through MDA5 (IFIH1) and MAVS (IPS1/CARDIF).
26564103 MDA5 mediates neuroprotection against cerebral ischemic injury.
26485346 These results showed that mRNA levels of MDA5 and RIG-1 were significantly decreased and increased, respectively, in chronic hepatitis B patients when compared to healthy controls.
26437794 These results demonstrate that poliovirus infection actively suppresses the host type I interferon response by blocking activation of IRF-3 and suggests that this is not mediated by cleavage of MDA-5 or IPS-1.
26385483 discusses the different risk and protective IFIH1 alleles in the context of recent structural and functional analysis that relate to MDA5 regulation of interferon responses
26351918 The MDA5 knockdown had no significant impact on the phosphorylation of eukaryotic translation initiation factor 2alpha triggered by CCCP, and MDA5 itself was not recruited to SGs, and the regulation of MDA5 in the SG response occurs downstream of eIF2alpha.
26284909 Results describe a family with gain of function mutation associated with cutaneous manifestations of Aicardi-Goutieres and Singleton-Merten syndromes
26215161 The study proposes that the turnover kinetics of the ATPase domain enables the discrimination of self/non-self RNA by both RIG-I and MDA5.
26208481 Findings indicate that melanoma differentiation associated protein-5 (MDA5) may serve as a complementary role in the toll-like receptor3 (TLR3) activated suppression of neuroblastoma (NB).
More...

AA Sequence

MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGV      1 - 70
WHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCME     71 - 140
EELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIE    141 - 210
NLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNM    211 - 280
GSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKK    281 - 350
KKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS    351 - 420
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS    421 - 490
PGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTR    491 - 560
IQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFY    561 - 630
NEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEK    631 - 700
LTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNE    701 - 770
QKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV    771 - 840
IEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNC    841 - 910
SVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLP    911 - 980
CLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDED                             981 - 1025
//

Text Mined References (189)

PMID Year Title
26782418 2015 Meta-analysis of STAT4 and IFIH1 polymorphisms in type 1 diabetes mellitus patients with autoimmune polyglandular syndrome type III.
26646717 2015 Human ?-Defensin 3 [corrected] Exacerbates MDA5 but Suppresses TLR3 Responses to the Viral Molecular Pattern Mimic Polyinosinic:Polycytidylic Acid.
26564103 2016 Cytosolic Receptor Melanoma Differentiation-Associated Protein 5 Mediates Preconditioning-Induced Neuroprotection Against Cerebral Ischemic Injury.
26485346 2015 Are RIG-1 and MDA5 Expressions Associated with Chronic HBV Infection?
26437794 2015 Proteolysis of MDA5 and IPS-1 is not required for inhibition of the type I IFN response by poliovirus.
26385483 2015 Effects of type 1 diabetes-associated IFIH1 polymorphisms on MDA5 function and expression.
26351918 2016 Melanoma differentiation-associated gene 5 is involved in the induction of stress granules and autophagy by protonophore CCCP.
26284909 2015 Unusual cutaneous features associated with a heterozygous gain-of-function mutation in IFIH1: overlap between Aicardi-Goutières and Singleton-Merten syndromes.
26215161 2015 Kinetic discrimination of self/non-self RNA by the ATPase activity of RIG-I and MDA5.
26208481 2015 MDA5 complements TLR3 in suppression of neuroblastoma.
More...