Property Summary

NCBI Gene PubMed Count 14
PubMed Score 18.49
PubTator Score 12.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 4.0e-31
osteosarcoma 7950 4.5e-05
intraductal papillary-mucinous carcinoma (IPMC) 2989 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
lung carcinoma -1.900 4.0e-31
osteosarcoma -1.574 4.5e-05

Gene RIF (4)

AA Sequence

MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCARSLEAVPKKLCGYLSKFGGKGPIRGWKSRWFF      1 - 70
YDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGIFEIKTPSRVITLKAATKQAMLYWLQQLQMK     71 - 140
RWEFHNSPPAPPATPDAALAGNGPVLHLELGQEEAELEEFLCPVKTPPGLVGVAAALQPFPALQNISLKH    141 - 210
LGTEIQNTMHNIRGNKQAQGTGHEPPGEDSPQSGEPQREEQPLASDASTPGREPEDSPKPAPKPSLTISF    211 - 280
AQKAKRQNNTFPFFSEGITRNRTAQEKVAALEQQVLMLTKELKSQKELVKILHKALEAAQQEKRASSAYL    281 - 350
AAAEDKDRLELVRHKVRQIAELGRRVEALEQERESLAHTASLREQQVQELQQHVQLLMDKNHAKQQVICK    351 - 420
LSEKVTQDFTHPPDQSPLRPDAANRDFLSQQGKIEHLKDDMEAYRTQNCFLNSEIHQVTKIWRKVAEKEK    421 - 490
ALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKY    491 - 560
DEYGFLTVPDYEVEDLKLLAKIQALESRSHHLLGLEAVDRPLRERWAALGDLVPSAELKQLLRAGVPREH    561 - 630
RPRVWRWLVHLRVQHLHTPGCYQELLSRGQAREHPAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLL    631 - 700
AFSWQNPTIGYCQGLNRLAAIALLVLEEEESAFWCLVAIVETIMPADYYCNTLTASQVDQRVLQDLLSEK    701 - 770
LPRLMAHLGQHHVDLSLVTFNWFLVVFADSLISNILLRVWDAFLYEGTKVVFRYALAIFKYNEKEILRLQ    771 - 840
NGLEIYQYLRFFTKTISNSRKLMNIAFNDMNPFRMKQLRQLRMVHRERLEAELRELEQLKAEYLERRASR    841 - 910
RRAVSEGCASEDEVEGEA                                                        911 - 928
//

Text Mined References (21)

PMID Year Title