Property Summary

NCBI Gene PubMed Count 14
PubMed Score 16.23
PubTator Score 12.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
post-traumatic stress disorder 45
Disease Target Count P-value
lung carcinoma 2844 3.9783412911769E-31
osteosarcoma 7933 4.53777973900096E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.010879810918081

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.574 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.011
lung carcinoma -1.900 0.000

Synonym

Accession Q9BYX2 B3KWD1 B4DQ05 B9A6J7 Q59EU0 Q5TBQ5 Q6IPC7 Q7L1K8 Q8WYT1 Q9H6A2 Q9NSH4
Symbols PARIS1
PARIS-1
TBC1D2A

Gene

PANTHER Protein Class (2)

PDB

2DHK  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (4)

PMID Text
23562278 Armus expression induces autophagosome accumulation in keratinocytes.
23285084 TBC1D2/Armus, a GAP of Rab7 GTPase, is reported as a novel target of miR-17.
20944657 Observational study of gene-disease association. (HuGE Navigator)
20583170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCARSLEAVPKKLCGYLSKFGGKGPIRGWKSRWFF      1 - 70
YDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGIFEIKTPSRVITLKAATKQAMLYWLQQLQMK     71 - 140
RWEFHNSPPAPPATPDAALAGNGPVLHLELGQEEAELEEFLCPVKTPPGLVGVAAALQPFPALQNISLKH    141 - 210
LGTEIQNTMHNIRGNKQAQGTGHEPPGEDSPQSGEPQREEQPLASDASTPGREPEDSPKPAPKPSLTISF    211 - 280
AQKAKRQNNTFPFFSEGITRNRTAQEKVAALEQQVLMLTKELKSQKELVKILHKALEAAQQEKRASSAYL    281 - 350
AAAEDKDRLELVRHKVRQIAELGRRVEALEQERESLAHTASLREQQVQELQQHVQLLMDKNHAKQQVICK    351 - 420
LSEKVTQDFTHPPDQSPLRPDAANRDFLSQQGKIEHLKDDMEAYRTQNCFLNSEIHQVTKIWRKVAEKEK    421 - 490
ALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKY    491 - 560
DEYGFLTVPDYEVEDLKLLAKIQALESRSHHLLGLEAVDRPLRERWAALGDLVPSAELKQLLRAGVPREH    561 - 630
RPRVWRWLVHLRVQHLHTPGCYQELLSRGQAREHPAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLL    631 - 700
AFSWQNPTIGYCQGLNRLAAIALLVLEEEESAFWCLVAIVETIMPADYYCNTLTASQVDQRVLQDLLSEK    701 - 770
LPRLMAHLGQHHVDLSLVTFNWFLVVFADSLISNILLRVWDAFLYEGTKVVFRYALAIFKYNEKEILRLQ    771 - 840
NGLEIYQYLRFFTKTISNSRKLMNIAFNDMNPFRMKQLRQLRMVHRERLEAELRELEQLKAEYLERRASR    841 - 910
RRAVSEGCASEDEVEGEA                                                        911 - 928
//

Text Mined References (21)

PMID Year Title
23562278 2013 The TBC/RabGAP Armus coordinates Rac1 and Rab7 functions during autophagy.
23285084 2012 miR-17-5p regulates endocytic trafficking through targeting TBC1D2/Armus.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
21269460 2011 Initial characterization of the human central proteome.
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20116244 2010 Armus is a Rac1 effector that inactivates Rab7 and regulates E-cadherin degradation.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...