Property Summary

NCBI Gene PubMed Count 15
PubMed Score 21.54
PubTator Score 10.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Male infertility 206 3.134 1.6

Gene RIF (8)

AA Sequence

MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCVPADRRANYPV      1 - 70
FCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG                                  71 - 111
//

Text Mined References (17)

PMID Year Title