Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $184,181.72
PubMed Score 0.00
PubTator Score 11.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BYW1 E9PH55 Q542Y4 Q6ICJ5 Q8WXF9 Q8WYM4
Symbols GLUT10
GLUT11

Gene

Gene RIF (7)

PMID Text
22452979 Critical roles for novel GLUT family members highlight a therapeutic strategy entailing selective GLUT inhibition to specifically target aberrant glucose metabolism in cancer.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
17710649 GLUT11 can also transport fructose, but it has the motif DSV at the same position, which appears to function in the same manner as NXI and when all three residues are replaced with NAV fructose transport lost.
16154905 Different promoters and splicing generate three SLC2A11 isoforms which are expressed in a tissue specific manner but do not appear to differ in their functional characteristics.
12175779 a novel sugar transporter that is alternatively spliced in various tissues

AA Sequence

MRALRRLIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEPLPDHLVLLMWSLI      1 - 70
VSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAGVSMN     71 - 140
IQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLRELLGGPQAWPLLLASCLVPGALQLASLPLLP    141 - 210
ESPRYLLIDCGDTEACLAALRRLRGSGDLAGELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVL    211 - 280
GSAMELCGNDSVYAYASSVFRKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTC    281 - 350
WGSIFTVALCLQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWIMLI    351 - 420
LVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFPRRAQGPTWRSLEV    421 - 490
IQSTEL                                                                    491 - 496
//

Text Mined References (17)

PMID Year Title
22452979 2012 Multiple myeloma exhibits novel dependence on GLUT4, GLUT8, and GLUT11: implications for glucose transporter-directed therapy.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
17710649 A highly conserved hydrophobic motif in the exofacial vestibule of fructose transporting SLC2A proteins acts as a critical determinant of their substrate selectivity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16154905 Characterization of the human SLC2A11 (GLUT11) gene: alternative promoter usage, function, expression, and subcellular distribution of three isoforms, and lack of mouse orthologue.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...