Property Summary

NCBI Gene PubMed Count 60
Grant Count 10
R01 Count 6
Funding $1,855,806.42
PubMed Score 77.31
PubTator Score 67.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Pathway (1)

Gene RIF (39)

PMID Text
26444573 The study identifies a strong association of Coeliac Disease with a network of BACH2 regulated genes, supporting emerging evidence of an important role of BACH2 in the regulation of T cell differentiation and prevention of autoimmune disease.
25873652 The investigated Bach2 gene polymorphisms (rs11755527, rs3757247, rs12212193 and rs2474619) are not related to the susceptibility to either Vogt-Koyanagi-Harada syndrome and Behcet's disease in our investigated Chinese Han population.
25670004 Gene expression analysis revealed that three gene BACH2, PTGER4 and ZFP36L1, are down-regulated in MS patients' blood cells compared to healthy subjects.
25444856 These observations suggested that the unstructured region of Bach2 is important for heme binding, and consequently for its functional regulation
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that BACH2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with BACH2
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that BACH2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with BACH2
24968937 There were multiple independent HIV integrations in several genes, including MKL2 and BACH2; many of these integrations were in clonally expanded cells.
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that BACH2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with BACH2
24858026 A restored BACH2 expression in BACH2-silenced gastric cancer cell lines, and knockdown of BACH2 using short hairpin RNA (i.e. RNA interference) increased cell proliferation in gastric cancer cells.
24608439 The type 1 diabetes candidate gene BACH2 regulates proinflammatory cytokine-induced apoptotic pathways in pancreatic beta-cells by crosstalk with another candidate gene, PTPN2, and activation of JNK1 and BIM.
More...

AA Sequence

MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQT      1 - 70
KNDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHNLEDSCFSFLQTQLLNSEDGL     71 - 140
FVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEP    141 - 210
DVPTDTKESSEKDALTQYPRYKKYQLACTKNVYNASSHSTSGFASTFREDNSSNSLKPGLARGQIKSEPP    211 - 280
SEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITKS    281 - 350
VELSGLPSTSQQHFARSPACPFDKGITQGDLKTDYTPFTGNYGQPHVGQKEVSNFTMGSPLRGPGLEALC    351 - 420
KQEGELDRRSVIFSSSACDQVSTSVHSYSGVSSLDKDLSEPVPKGLWVGAGQSLPSSQAYSHGGLMADHL    421 - 490
PGRMRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSLPLCEFSSSPCSQGARFLATE    491 - 560
HQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEADSESCPVQDRGQEVKLPFPVDQITDLPRNDF    561 - 630
QMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMG    631 - 700
ELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL    701 - 770
EPGAAPPGPPWAPSNTSENCTSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY    771 - 840
T//

Text Mined References (61)

PMID Year Title
26444573 2015 Transcriptome Analysis of CD4+ T Cells in Coeliac Disease Reveals Imprint of BACH2 and IFN? Regulation.
25873652 2015 No association between Bach2 gene polymorphisms with Vogt-Koyanagi-Harada syndrome (VKH) and Behcet's disease (BD) in a Chinese Han population.
25670004 2015 Anti-inflammatory genes associated with multiple sclerosis: a gene expression study.
25444856 2015 Heme binds to an intrinsically disordered region of Bach2 and alters its conformation.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24968937 2014 HIV latency. Specific HIV integration sites are linked to clonal expansion and persistence of infected cells.
24858026 2014 Epigenetic silencing of BTB and CNC homology 2 and concerted promoter CpG methylation in gastric cancer.
24608439 2014 BACH2, a candidate risk gene for type 1 diabetes, regulates apoptosis in pancreatic ?-cells via JNK1 modulation and crosstalk with the candidate gene PTPN2.
24586183 2014 Identification of novel genetic Loci associated with thyroid peroxidase antibodies and clinical thyroid disease.
24450488 2014 Association between BACH2 expression and clinical prognosis in diffuse large B-cell lymphoma.
More...