Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.40
PubTator Score 4.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.500 4.0e-02
ductal carcinoma in situ 1.600 1.3e-02
group 3 medulloblastoma 1.500 1.4e-03
invasive ductal carcinoma 2.000 3.8e-03
lung carcinoma 1.300 2.0e-13
non-small cell lung cancer 1.324 4.9e-14
ovarian cancer 1.600 5.9e-04
Pick disease -1.600 7.2e-03
pituitary cancer 1.100 3.5e-05
subependymal giant cell astrocytoma -2.093 1.3e-02

 IMPC Phenotype (1)

Gene RIF (3)

AA Sequence

MSLRRHIGNPEYLMKRIPQNPRYQHIKSRLDTGNSMTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLI      1 - 70
IQVASLSDQTLEVTAEEIQRLEDNDSAASDPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQ     71 - 140
SVISGVGELDLDKGPVKKAEPHTKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSND    141 - 210
ILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLITGSLPASCQQALPP    211 - 280
GSARKRSSPKGPPLPAENKWRFTPEDLKKIEYYLEEEQGPADHPSRLNQANSSGRESKVPGARSAQNLPG    281 - 350
GGPASHSNPRSLSSGHLQGKPWK                                                   351 - 373
//

Text Mined References (18)

PMID Year Title