Property Summary

NCBI Gene PubMed Count 8
Grant Count 27
R01 Count 14
Funding $2,754,750.6
PubMed Score 39.59
PubTator Score 14.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 0.000
adult high grade glioma -1.100 0.003
psoriasis -1.100 0.004

Gene RIF (2)

PMID Text
25801283 A novel protein aggregate myopathies and cardiomyopathy resulting from combined homozygous MuRF1 null mutation and heterozygous MuRF3 missense mutation.
10953002 Functional analysis of the mouse counterpart.

AA Sequence

MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNPLWQSRGSTTV      1 - 70
SSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLS     71 - 140
CEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQK    141 - 210
QLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYL    211 - 280
QQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGP    281 - 350
EEERPDGP                                                                  351 - 358
//

Text Mined References (9)

PMID Year Title
25801283 2015 New cardiac and skeletal protein aggregate myopathy associated with combined MuRF1 and MuRF3 mutations.
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11243782 2001 Identification of muscle specific ring finger proteins as potential regulators of the titin kinase domain.
10953002 2000 Regulation of microtubule dynamics and myogenic differentiation by MURF, a striated muscle RING-finger protein.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.