Property Summary

NCBI Gene PubMed Count 9
PubMed Score 36.71
PubTator Score 14.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
glioblastoma 5792 3.5e-05
adult high grade glioma 3801 2.7e-03
psoriasis 6694 4.3e-03
Disease Target Count Z-score Confidence
Hypertrophic Cardiomyopathy 117 3.228 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 2.7e-03
glioblastoma -1.100 3.5e-05
psoriasis -1.100 4.3e-03

Gene RIF (2)

AA Sequence

MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNPLWQSRGSTTV      1 - 70
SSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLS     71 - 140
CEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQK    141 - 210
QLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYL    211 - 280
QQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGP    281 - 350
EEERPDGP                                                                  351 - 358
//

Text Mined References (10)

PMID Year Title