Property Summary

NCBI Gene PubMed Count 30
PubMed Score 32.00
PubTator Score 21.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Metabolism, Inborn Errors 17 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.8e-06
osteosarcoma 7950 4.5e-05
pancreatic ductal adenocarcinoma liver metastasis 1962 6.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Primary hyperoxaluria 15 3.06 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.167 4.5e-05
pancreatic ductal adenocarcinoma liver m... -1.746 6.5e-03
psoriasis -1.800 3.8e-06

Gene RIF (12)

AA Sequence

MTLIWRHLLRPLCLVTSAPRILEMHPFLSLGTSRTSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIH      1 - 70
KEHLSPVVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCHPKVNAVAQKQLGRLWHTSTV     71 - 140
FFHPPMHEYAEKLAALLPEPLKVIFLVNSGSEANELAMLMARAHSNNIDIISFRGAYHGCSPYTLGLTNV    141 - 210
GTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKS    211 - 280
IAGFFAEPIQGVNGVVQYPKGFLKEAFELVRARGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAK    281 - 350
GIGNGFPMAAVITTPEIAKSLAKCLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQEVGTYMLLKFAK    351 - 420
LRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCIT    421 - 490
KPEVDFAVEVFRSALTQHMERRAK                                                  491 - 514
//

Text Mined References (33)

PMID Year Title