Property Summary

NCBI Gene PubMed Count 27
PubMed Score 28.85
PubTator Score 21.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.167 0.000
pancreatic ductal adenocarcinoma liver m... -1.746 0.006
psoriasis -1.800 0.000

Synonym

Accession Q9BYV1 B7ZM47 E9PDL7 Q53FB4 Q53FY7 Q53G03 Q5W7Q1 AGT 2
Symbols AGT2
DAIBAT

Gene

PANTHER Protein Class (2)

Gene RIF (9)

PMID Text
25620171 The AGXT2 genotype may be an important factor underlying atherosclerosis.
24834905 AGXT2 rs37369 polymorphism is associated with increased risk for CHD in smokers and in diabetes mellitus patients
24727203 The results of this study that the AGXT2 gene is not associated with schizophrenia in Japanese subjects.
24586340 SNPs of AGXT2 affect plasma as well as urinary BAIB.
24159190 AGXT2 has an important role in SDMA metabolism in humans and may additionally have an unanticipated role in the autonomic nervous system regulation of cardiac function.
23023372 Alanine-glyoxylate aminotransferase-2 metabolizes endogenous methylarginines, regulates NO, and controls blood pressure.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20018850 mitochondrially localized human AGXT2 is able to effectively metabolize ADMA in vivo resulting in decreased ADMA levels and improved endothelial NO production.
7592550 Discusses the cloning of the rat gene.

AA Sequence

MTLIWRHLLRPLCLVTSAPRILEMHPFLSLGTSRTSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIH      1 - 70
KEHLSPVVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCHPKVNAVAQKQLGRLWHTSTV     71 - 140
FFHPPMHEYAEKLAALLPEPLKVIFLVNSGSEANELAMLMARAHSNNIDIISFRGAYHGCSPYTLGLTNV    141 - 210
GTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKS    211 - 280
IAGFFAEPIQGVNGVVQYPKGFLKEAFELVRARGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAK    281 - 350
GIGNGFPMAAVITTPEIAKSLAKCLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQEVGTYMLLKFAK    351 - 420
LRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCIT    421 - 490
KPEVDFAVEVFRSALTQHMERRAK                                                  491 - 514
//

Text Mined References (30)

PMID Year Title
25620171 Missense variants of the alanine: glyoxylate aminotransferase 2 gene correlated with carotid atherosclerosis in the Japanese population.
25294000 2014 AGXT2: a promiscuous aminotransferase.
25245031 2014 Genome-wide association study of L-arginine and dimethylarginines reveals novel metabolic pathway for symmetric dimethylarginine.
25002409 2014 Role of alanine:glyoxylate aminotransferase 2 in metabolism of asymmetric dimethylarginine in the settings of asymmetric dimethylarginine overload and bilateral nephrectomy.
24834905 2014 Association of the AGXT2 V140I polymorphism with risk for coronary heart disease in a Chinese population.
24727203 2014 Missense variants of the alanine:glyoxylate aminotransferase 2 gene are not associated with Japanese schizophrenia patients.
24586340 2014 Alanine-glyoxylate aminotransferase 2 (AGXT2) polymorphisms have considerable impact on methylarginine and ?-aminoisobutyrate metabolism in healthy volunteers.
24586186 2014 Genome-wide association study of metabolic traits reveals novel gene-metabolite-disease links.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24186881 2014 Genetic and environmental determinants of dimethylarginines and association with cardiovascular disease in patients with type 2 diabetes.
More...