Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.17
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.2e-04
Atopic dermatitis 952 2.7e-02

AA Sequence

MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ      1 - 70
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCSTTCRTSSC                 71 - 128
//

Text Mined References (4)

PMID Year Title