Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.17
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Atopic dermatitis 944
psoriasis 6,685

Synonym

Accession Q9BYU5
Symbols KAP2.1A
KRTAP2.1A

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ      1 - 70
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCSTTCRTSSC                 71 - 128
//

Text Mined References (4)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.
11181995 2001 The sequence of the human genome.