Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.86
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Gene RIF (5)

AA Sequence

MAAPPRPAPSPPAPRRLDTSDVLQQIMAITDQSLDEAQARKHALNCHRMKPALFSVLCEIKEKTVVSIRG      1 - 70
IQDEDPPDAQLLRLDNMLLAEGVCRPEKRGRGGAVARAGTATPGGCPNDNSIEHSDYRAKLSQIRQIYHS     71 - 140
ELEKYEQACREFTTHVTNLLQEQSRMRPVSPKEIERMVGAIHGKFSAIQMQLKQSTCEAVMTLRSRLLDA    141 - 210
RRKRRNFSKQATEVLNEYFYSHLNNPYPSEEAKEELARKGGLTISQVSNWFGNKRIRYKKNMGKFQEEAT    211 - 280
IYTGKTAVDTTEVGVPGNHASCLSTPSSGSSGPFPLPSAGDAFLTLRTLASLQPPPGGGCLQSQAQGSWQ    281 - 350
GATPQPATASPAGDPGSINSSTSN                                                  351 - 374
//

Text Mined References (18)

PMID Year Title