Property Summary

NCBI Gene PubMed Count 20
PubMed Score 15.22
PubTator Score 17.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.100 9.3e-03
astrocytic glioma -3.800 1.2e-03
Astrocytoma, Pilocytic -2.600 2.2e-03
atypical teratoid / rhabdoid tumor -4.700 4.9e-09
ductal carcinoma in situ -1.200 4.5e-03
ependymoma -4.300 4.9e-04
glioblastoma -2.500 1.6e-04
group 3 medulloblastoma -3.400 3.8e-02
intraductal papillary-mucinous adenoma (... 1.200 3.5e-02
invasive ductal carcinoma -1.100 1.8e-02
medulloblastoma, large-cell -4.800 1.4e-03
oligodendroglioma -3.700 3.4e-03
pituitary cancer 2.300 6.4e-03
primitive neuroectodermal tumor -4.700 1.5e-04
severe Alzheimer's disease -1.523 4.3e-02

Gene RIF (11)

AA Sequence

MVHHSGSIQSFKQQKGMNISKSEITKETSLKPSRRSLPCLAQSYAYSKSLSQSTSLFQSTESESQAPTSI      1 - 70
TLISTDKAEQVNTEENKNDSVLRCSFADLSDFCLALGKDKDYTDESEHATYDRSRLINDFVIKDKSEFKT     71 - 140
KLSKNDMNYIASSGPLFKDGKKRIDYILVYRKTNIQYDKRNTFEKNLRAEGLMLEKEPAIASPDIMFIKI    141 - 210
HIPWDTLCKYAERLNIRMPFRKKCYYTDGRSKSMGRMQTYFRRIKNWMAQNPMVLDKSAFPDLEESDCYT    211 - 280
GPFSRARIHHFIINNKDTFFSNATRSRIVYHMLERTKYENGISKVGIRKLINNGSYIAAFPPHEGAYKSS    281 - 350
QPIKTHGPQNNRHLLYERWARWGMWYKHQPLDLIRLYFGEKIGLYFAWLGWYTGMLIPAAIVGLCVFFYG    351 - 420
LFTMNNSQVSQEICKATEVFMCPLCDKNCSLQRLNDSCIYAKVTYLFDNGGTVFFAIFMAIWATVFLEFW    421 - 490
KRRRSILTYTWDLIEWEEEEETLRPQFEAKYYKMEIVNPITGKPEPHQPSSDKVTRLLVSVSGIFFMISL    491 - 560
VITAVFGVVVYRLVVMEQFASFKWNFIKQYWQFATSAAAVCINFIIIMLLNLAYEKIAYLLTNLEYPRTE    561 - 630
SEWENSFALKMFLFQFVNLNSSIFYIAFFLGRFVGHPGKYNKLFDRWRLEECHPSGCLIDLCLQMGVIMF    631 - 700
LKQIWNNFMELGYPLIQNWWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIFVA    701 - 770
AFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLPARATDIGIWLGILEGIGILAVITNAFVIAITSDYIPR    771 - 840
FVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSELGMGKSGYCRYRDYRGPPWSSKPYEFTLQYWHIL    841 - 910
AARLAFIIVFEHLVFGIKSFIAYLIPDVPKGLHDRIRREKYLVQEMMYEAELEHLQQQRRKSGQPVHHEW    911 - 980
P//

Text Mined References (24)

PMID Year Title