Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
Funding $257,736.58
PubMed Score 12.14
PubTator Score 9.90

Knowledge Summary

Patent (1,202)

Expression

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2661 screening 235 / 0 / 321673 Luminescence Cell-Free Homogenous Primary HTS to Identify Inhibitors of Serine/Threonine Kinase 33 Activity
2689 summary 2 / 0 / 0 Summary of Broad Institute MLPCN Serine Threonine Kinase 33 Inhibitor Project
2821 confirmatory 174 / 0 / 50 Luminescence Cell-Free Homogenous Dose Retest to Identify Inhibitors of Serine/Threonine Kinase 33 Activity
588480 confirmatory 26 / 17 / 14 STK-33 Kinase Inhibition Measured in Biochemical System Using Plate Reader - 2052-02_Inhibitor_Dose_DryPowder_Activity_Set2
588632 confirmatory 29 / 4 / 23 STK-33 Kinase Inhibition Measured in Biochemical System Using Plate Reader - 2052-02_Inhibitor_Dose_DryPowder_Activity
602158 confirmatory 10 / 1 / 14 STK-33 Kinase Inhibition Measured in Biochemical System Using Plate Reader - 2052-02_Inhibitor_Dose_DryPowder_Activity_Set3

Gene RIF (8)

PMID Text
25662617 STK33 can promote cell migration and invasion and suppress p53 gene expression in the NL9980 and L9981 large cell lung cancer cell lines. In addition, this protein also promotes epithelial-mesenchymal transition.
25603720 Results show that STK33 is a potential oncogene and a promising diagnostic marker for hypopharyngeal squamous cell carcinoma (HSCC). STK33 may promote tumorigenesis and progression of HSCC, and serve as a valuable molecular target for treatment of HSCC.
25398772 STK33 plays an essential role in hepatocellular proliferation and liver tumorigenesis. STK33 may bind directly to c-Myc and increase its transcriptional activity.
23967198 The STK33-linked SNP rs4929949 is associated with obesity and BMI in two independent cohorts of Swedish and Greek children.
21742770 STK33 downregulation or dominant mutant overexpression had no effect on KRAS signaling or survival of cancer cells.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16176263 STK33/Stk33 expression pattern resembles those of some related members of the calcium/calmodulin dependent kinase group

AA Sequence

MADSGLDKKSTKCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDIT      1 - 70
SRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETET     71 - 140
KWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHF    141 - 210
SENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKSSLIDDNNEINLNIKVTDFGLAVKKQSRSEAML    211 - 280
QATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFENAVWNSI    281 - 350
SDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEEKNKPS    351 - 420
TEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPV    421 - 490
TPSQGTATKYPAKSGALSRTKKKL                                                  491 - 514
//

Text Mined References (21)

PMID Year Title
25662617 2015 STK33 plays an important positive role in the development of human large cell lung cancers with variable metastatic potential.
25603720 2015 STK33 overexpression in hypopharyngeal squamous cell carcinoma: possible role in tumorigenesis.
25398772 2016 STK33 promotes hepatocellular carcinoma through binding to c-Myc.
23967198 2013 The STK33-linked SNP rs4929949 is associated with obesity and BMI in two independent cohorts of Swedish and Greek children.
21742770 2011 STK33 kinase activity is nonessential in KRAS-dependent cancer cells.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19079261 2009 Six new loci associated with body mass index highlight a neuronal influence on body weight regulation.
More...