Property Summary

Ligand Count 8
NCBI Gene PubMed Count 19
PubMed Score 17.67
PubTator Score 9.90

Knowledge Summary

Patent (1,202)

Expression

  Differential Expression (11)

Gene RIF (10)

AA Sequence

MADSGLDKKSTKCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDIT      1 - 70
SRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETET     71 - 140
KWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHF    141 - 210
SENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKSSLIDDNNEINLNIKVTDFGLAVKKQSRSEAML    211 - 280
QATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFENAVWNSI    281 - 350
SDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEEKNKPS    351 - 420
TEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPV    421 - 490
TPSQGTATKYPAKSGALSRTKKKL                                                  491 - 514
//

Text Mined References (23)

PMID Year Title