Property Summary

NCBI Gene PubMed Count 14
PubMed Score 40.37
PubTator Score 19.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
POROKERATOSIS 8, DISSEMINATED SUPERFICIAL ACTINIC TYPE 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.9e-10
malignant mesothelioma 3232 4.8e-07
cystic fibrosis 1696 9.9e-06
active ulcerative colitis 764 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Keratosis 37 3.801 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis 1.178 2.4e-02
cystic fibrosis -1.423 9.9e-06
malignant mesothelioma 1.900 4.8e-07
ovarian cancer 1.400 1.9e-10

Gene RIF (7)

AA Sequence

MQPPPDEARRDMAGDTQWSRPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFF      1 - 70
WGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAFMTFSRILMGLLQGVYFPALT     71 - 140
SLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEWYGWQSIFYFSGGLTLLWVWYVYRYLLSEKD    141 - 210
LILALGVLAQSRPVSRHNRVPWRRLFRKPAVWAAVVSQLSAACSFFILLSWLPTFFEETFPDAKGWIFNV    211 - 280
VPWLVAIPASLFSGFLSDHLINQGYRAITVRKLMQGMGLGLSSVFALCLGHTSSFCESVVFASASIGLQT    281 - 350
FNHSGISVNIQDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLMETTGSWTCLFNLVAIISNLGLCTFLV    351 - 420
FGQAQRVDLSSTHEDL                                                          421 - 436
//

Text Mined References (14)

PMID Year Title