Property Summary

NCBI Gene PubMed Count 14
Grant Count 18
R01 Count 5
Funding $1,629,824.42
PubMed Score 36.56
PubTator Score 19.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
cystic fibrosis -1.440 0.000
active ulcerative colitis 1.178 0.024
ovarian cancer 1.400 0.000

Gene RIF (7)

PMID Text
25180256 Results identified SLC17A9 as another pathogenic gene for DSAP, which suggests a correlation between the aberrant vesicular nucleotide transporter and the pathogenesis of DSAP.
24962569 data suggest that SLC17A9 activity mediates lysosomal ATP accumulation and plays an important role in lysosomal physiology and cell viability.
24292772 It is suggested that the functions of VNUT, in addition to P2 receptors may be a target for anti-inflammatory response in skin.
23467297 These results suggest that SLC17A9 is the relevant nucleotide transporter responsible for the uptake of cytosolic nucleotides into mucin granules.
21613220 the existence of an SLC17A9-dependent ATP-enriched vesicular pool in biliary epithelium that undergoes regulated exocytosis to initiate purinergic signaling.
20382737 analysis of involvement of SLC17A9-dependent vesicular exocytosis in the mechanism of ATP release during T cell activation
18375752 SLC17A9 protein acts as a vesicular nucleotide transporter (VNUT) and plays an essential role in vesicular storage of ATP in the ATP-secreting cells [SLC17A9]

AA Sequence

MQPPPDEARRDMAGDTQWSRPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFF      1 - 70
WGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAFMTFSRILMGLLQGVYFPALT     71 - 140
SLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEWYGWQSIFYFSGGLTLLWVWYVYRYLLSEKD    141 - 210
LILALGVLAQSRPVSRHNRVPWRRLFRKPAVWAAVVSQLSAACSFFILLSWLPTFFEETFPDAKGWIFNV    211 - 280
VPWLVAIPASLFSGFLSDHLINQGYRAITVRKLMQGMGLGLSSVFALCLGHTSSFCESVVFASASIGLQT    281 - 350
FNHSGISVNIQDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLMETTGSWTCLFNLVAIISNLGLCTFLV    351 - 420
FGQAQRVDLSSTHEDL                                                          421 - 436
//

Text Mined References (14)

PMID Year Title
25180256 2014 Exome sequencing identifies SLC17A9 pathogenic gene in two Chinese pedigrees with disseminated superficial actinic porokeratosis.
24962569 2014 SLC17A9 protein functions as a lysosomal ATP transporter and regulates cell viability.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24292772 2014 Mechanism underlying ATP release in human epidermal keratinocytes.
23467297 2013 Vesicular nucleotide transporter regulates the nucleotide content in airway epithelial mucin granules.
21613220 2011 Regulation of purinergic signaling in biliary epithelial cells by exocytosis of SLC17A9-dependent ATP-enriched vesicles.
20382737 2010 Involvement of SLC17A9-dependent vesicular exocytosis in the mechanism of ATP release during T cell activation.
18375752 2008 Identification of a vesicular nucleotide transporter.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...