Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.61
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.54308900108325E-9
malignant mesothelioma 3163 1.34548098486588E-8
medulloblastoma 1524 1.56408761477226E-8
Duchenne muscular dystrophy 602 6.459827307083E-7
medulloblastoma, large-cell 6234 6.19867683953843E-6
glioblastoma 5572 1.28424360525479E-5
pituitary cancer 1972 6.98147112174395E-5
primitive neuroectodermal tumor 3031 7.49954852854883E-5
limb girdle muscular dystrophy 2A 156 8.98347626105112E-5
atypical teratoid / rhabdoid tumor 4369 5.64067380410175E-4
Atopic dermatitis 944 5.88497537614863E-4
ductal carcinoma in situ 1745 0.00352877145150721
lung adenocarcinoma 2714 0.0074860216045548
astrocytic glioma 2241 0.00924788346527589
psoriasis 6685 0.0102566633694272
pediatric high grade glioma 2712 0.0108508669342314
oligodendroglioma 2849 0.0141209522944354
invasive ductal carcinoma 2950 0.019357741109679
osteosarcoma 7933 0.0358337501884581
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 2.0

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -6.500 0.000
astrocytic glioma -2.700 0.009
oligodendroglioma -2.600 0.014
psoriasis -1.500 0.010
osteosarcoma -1.180 0.036
medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -2.700 0.001
glioblastoma -2.800 0.000
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -3.100 0.000
limb girdle muscular dystrophy 2A -1.352 0.000
Duchenne muscular dystrophy -1.222 0.000
Atopic dermatitis -1.700 0.001
pediatric high grade glioma -1.600 0.011
lung adenocarcinoma 2.400 0.007
ductal carcinoma in situ -1.200 0.004
invasive ductal carcinoma -1.300 0.019
ovarian cancer -1.600 0.000
pituitary cancer -1.900 0.000

Synonym

Accession Q9BYS8 B2RDQ7 Q96LT5
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
22082156 Knockdown of leucine rich repeat containing 2 (LRRC2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFID      1 - 70
TSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYI     71 - 140
QLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFEL    141 - 210
SNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSML    211 - 280
NLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIE    281 - 350
DLKERESVPSYTTKVSFSLQL                                                     351 - 371
//

Text Mined References (12)

PMID Year Title
21606681 2011 Leucine-rich repeat (LRR) proteins: integrators of pattern recognition and signaling in immunity.
20616063 2011 Human leucine-rich repeat proteins: a genome-wide bioinformatic categorization and functional analysis in innate immunity.
20420713 2010 Identifying mRNA targets of microRNA dysregulated in cancer: with application to clear cell Renal Cell Carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16432833 2006 Down regulation of 3p genes, LTF, SLC38A3 and DRR1, upon growth of human chromosome 3-mouse fibrosarcoma hybrids in severe combined immunodeficiency mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461651 2002 Comparative human/murine sequence analysis of the common eliminated region 1 from human 3p21.3.
More...