Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.61
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.600 2.1e-02
astrocytic glioma -2.700 9.2e-03
Atopic dermatitis -1.700 5.9e-04
atypical teratoid / rhabdoid tumor -2.700 5.6e-04
Duchenne muscular dystrophy -1.222 6.5e-07
ductal carcinoma in situ -1.200 3.5e-03
glioblastoma -2.800 1.3e-05
group 4 medulloblastoma -2.300 2.8e-03
invasive ductal carcinoma -1.300 1.9e-02
limb girdle muscular dystrophy 2A -1.352 9.0e-05
lung adenocarcinoma 2.400 7.5e-03
malignant mesothelioma -6.500 1.3e-08
medulloblastoma, large-cell -3.300 6.2e-06
oligodendroglioma -2.600 1.4e-02
osteosarcoma -1.180 3.6e-02
ovarian cancer -1.600 2.5e-09
pituitary cancer -1.900 7.0e-05
primitive neuroectodermal tumor -3.100 7.5e-05
psoriasis -1.200 1.9e-04

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFID      1 - 70
TSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYI     71 - 140
QLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFEL    141 - 210
SNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSML    211 - 280
NLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIE    281 - 350
DLKERESVPSYTTKVSFSLQL                                                     351 - 371
//

Text Mined References (12)

PMID Year Title