Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BYS1 A6NJW6 A6NLZ6 B6ZDR1 Q52LP6
Symbols KAP1.5
KRTAP1.5

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
12228244 no polymorphic alleles were found for the hKAP1.4 and hKAP1.5 genes in Japanese and Caucasian individuals

AA Sequence

MTCCQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQPSCCETSC      1 - 70
CQPSCCETSCCQPSCCQISSCGTGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTP     71 - 140
PSCCQLHHAQASCCRPSYCGQSCCRPVCCCEPTC                                        141 - 174
//

Text Mined References (5)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228244 2002 Polymorphisms in the human high sulfur hair keratin-associated protein 1, KAP1, gene family.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.