Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 1.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
cystic fibrosis 1696 9.0e-05
psoriasis 6694 3.7e-04
diabetes mellitus 1728 1.3e-03
Hydrolethalus syndrome 128 1.6e-02
Atopic dermatitis 952 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.800 1.9e-02
cystic fibrosis 2.150 9.0e-05
diabetes mellitus 1.100 1.3e-03
Hydrolethalus syndrome 3.948 1.6e-02
psoriasis -1.100 3.7e-04

Gene RIF (1)

AA Sequence

MTCCQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQPSCCETSC      1 - 70
CQPSCCETSCCQPSCCQISSCGTGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTP     71 - 140
PSCCQLHHAQASCCRPSYCGQSCCRPVCCCEPTC                                        141 - 174
//

Text Mined References (6)

PMID Year Title