Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.6e-04
Atopic dermatitis 952 1.3e-02

AA Sequence

MDCCASRGCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPTCCDNCPPPCHIPQPCVPTCFLLNS      1 - 70
CQPTPGLETLNLTTFTQPCCEPCLPRGC                                               71 - 98
//

Text Mined References (5)

PMID Year Title