Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.08
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.3e-04
diabetes mellitus 1728 1.6e-03
Atopic dermatitis 952 1.3e-02
non primary Sjogren syndrome sicca 891 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MVSSCCGSVCSDQSCGQGLGQESCCRPSCCQTTCCRTTCCRPSCCISSCCRPSCCISSCCKPSCCRTTCC      1 - 70
RPSCCISSCCRPSCCISSCCKPSCCRTTCCRPSCCISSCCRPSCCISSCCKPSCCQTTCCRPSCCISSCY     71 - 140
RPQCCQPSCCRPACCISSCCHPSCCVSSCRCPFSCPTTCCRTTCFHPICCGSSCC                   141 - 195
//

Text Mined References (4)

PMID Year Title