Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.08
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.3330179036874E-4
diabetes mellitus 1663 0.00155117031022915
Atopic dermatitis 944 0.0126998135528678
non primary Sjogren syndrome sicca 840 0.0249246561870206

Synonym

Accession Q9BYR4
Symbols KAP4.3

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

 GO Component (1)

 GO Process (2)

 Compartment GO Term (0)

AA Sequence

MVSSCCGSVCSDQSCGQGLGQESCCRPSCCQTTCCRTTCCRPSCCISSCCRPSCCISSCCKPSCCRTTCC      1 - 70
RPSCCISSCCRPSCCISSCCKPSCCRTTCCRPSCCISSCCRPSCCISSCCKPSCCQTTCCRPSCCISSCY     71 - 140
RPQCCQPSCCRPACCISSCCHPSCCVSSCRCPFSCPTTCCRTTCFHPICCGSSCC                   141 - 195
//

Text Mined References (4)

PMID Year Title
21916889 2011 Hair greying is associated with active hair growth.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15955084 2005 Size polymorphisms in the human ultrahigh sulfur hair keratin-associated protein 4, KAP4, gene family.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.