Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.5e-04
diabetes mellitus 1728 1.1e-03
Atopic dermatitis 952 1.3e-02

AA Sequence

MVNSCCGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCCVSSC      1 - 70
CRPQCCQSVCCQPTCCRPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTCCCPSYCVSSCCRPQCCQTTC     71 - 140
CRTTCCRPSCCVSRCYRPHCGQSLCC                                                141 - 166
//

Text Mined References (3)

PMID Year Title