Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q9BYR3 Q9BYU7
Symbols KAP4.4
KAP4.13
KRTAP4.4
KRTAP4-13
KRTAP4.13

Gene

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MVNSCCGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCCVSSC      1 - 70
CRPQCCQSVCCQPTCCRPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTCCCPSYCVSSCCRPQCCQTTC     71 - 140
CRTTCCRPSCCVSRCYRPHCGQSLCC                                                141 - 166
//

Text Mined References (3)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15955084 2005 Size polymorphisms in the human ultrahigh sulfur hair keratin-associated protein 4, KAP4, gene family.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.