Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.9e-04
Atopic dermatitis 952 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

AA Sequence

MVSSCCGSVCSDQGCSQDLCQETCCRPSCCQTTCCRTTCYRPSCCVSSCCRPQCCQSVCCQPTCCRPTCC      1 - 70
ETTCCHPRCCISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHPSCCISSCCRPSCCVSRCCRPQCCQSVCC     71 - 140
QPTCCRPSCCISSCCRPSCCESSCCRPSCCRPCCCLRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC    141 - 210
//

Text Mined References (6)

PMID Year Title