Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.6e-06
psoriasis 6694 3.9e-04
Atopic dermatitis 952 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MVNSCCGSVCSDQGCGQDLCQETCCCPSCCQTTCCRTTCYRPSYSVSCCCRPQCCQSVCCQPTCCRPSCC      1 - 70
VSSCCKPQCCQSVCCQPTCCHPSCCISSCCRPSCCVSSCCKPQCCQSVCCQPNCCRPSCSISSCCRPSCC     71 - 140
ESSCCRPCCCLRPVCGRVSCHTTCYRPACVISTCPRPVCCASSCC                             141 - 185
//

Text Mined References (5)

PMID Year Title