Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 2.7e-04
psoriasis 6694 6.9e-04
Atopic dermatitis 952 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCCQPTCVTSC      1 - 70
CQPSCCSTPCCQPTCCGSSCDQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSNCCQPCCRPACCETTCF     71 - 140
QPTCVSSCCQPFCC                                                            141 - 154
//

Text Mined References (5)

PMID Year Title