Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Atopic dermatitis 944
psoriasis 6,685

Synonym

Accession Q9BYP9 B5MDD6 Q9BYQ1
Symbols KAP9.5
KAP9.9
KRTAP9-5
KRTAP9.9

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPACCQNTCCRTTCCQPT      1 - 70
CLSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCF     71 - 140
QPTCVSSCCQPSCC                                                            141 - 154
//

Text Mined References (2)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.