Property Summary

NCBI Gene PubMed Count 28
Grant Count 12
R01 Count 12
Funding $1,052,867.5
PubMed Score 16.53
PubTator Score 13.80

Knowledge Summary

Patent (1,442)

Expression

  Differential Expression (9)

Gene RIF (18)

PMID Text
26069258 WNK3 knockout mice exhibited significantly decreased infarct volume in a transgenic model of stroke and brain damage.
24920754 There may be a novel role for WNK3 on the renal Na+-Cl-cotransporter (NCC) expression at the plasma membrane, an effect apparently independent of the SPAK kinase and the aldosterone-SGK1 pathway.
23482566 LINGO-1 potentiates neuronal apoptosis, likely by inhibiting WNK3 kinase activity.
22864523 WNK3 modulates intracellular Cl(-) concentration and regulatory volume decrease in HEK293 cells.
21813709 Analysis of the data showed that WNK3 is an essential regulator of NKCC1 and that WNK3 activates NKCC1-mediated ion transport necessary for cell volume changes associated with cell invasion.
21613606 The Wnk3 protein isoforms have a similar effect on SLC12 cotransporters. NKCC1/2 and NCC were inhibited, even in hypertonicity, while KCCs were activated, even in isotonic conditions.
20819979 OXSR1 and WNK3 transcripts were substantially overexpressed in subjects with schizophrenia relative to comparison subjects.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20525693 Data find that expression of the N termini of all four WNKs results in modest to strong activation of SGK1.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MATDSGDPASTEDSEKPDGISFENRVPQVAATLTVEARLKEKNSTFSASGETVERKRFFRKSVEMTEDDK      1 - 70
VAESSPKDERIKAAMNIPRVDKLPSNVLRGGQEVKYEQCSKSTSEISKDCFKEKNEKEMEEEAEMKAVAT     71 - 140
SPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKLTKAEQQRFKEEAEMLKGLQHPNIVRFY    141 - 210
DSWESILKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDN    211 - 280
IFITGPTGSVKIGDLGLATLMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSE    281 - 350
CQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVELAEEDD    351 - 420
CSNSSLALRLWVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAVAKSIRDRVTP    421 - 490
IKKTREKKPAGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHC    491 - 560
SSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGL    561 - 630
QKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKVPQIKPVSQPVGAEQQAALLKPDLVR    631 - 700
SLNQDVATTKENVSSPDNPSGNGKQDRIKQRRASCPRPEKGTKFQLTVLQVSTSGDNMVECQLETHNNKM    701 - 770
VTFKFDVDGDAPEDIADYMVEDNFVLESEKEKFVEELRAIVGQAQEILHVHFATERATGVDSITVDSNSS    771 - 840
QTGSSEQVQINSTSTQTSNESAPQSSPVGRWRFCINQTIRNRETQSPPSLQHSMSAVPGRHPLPSPKNTS    841 - 910
NKEISRDTLLTIENNPCHRALFTSKSEHKDVVDGKISECASVETKQPAILYQVEDNRQIMAPVTNSSSYS    911 - 980
TTSVRAVPAECEGLTKQASIFIPVYPCHQTASQADALMSHPGESTQTSGNSLTTLAFDQKPQTLSVQQPA    981 - 1050
MDAEFISQEGETTVNTEASSPKTVIPTQTPGLEPTTLQPTTVLESDGERPPKLEFADNRIKTLDEKLRNL   1051 - 1120
LYQEHSISSIYPESQKDTQSIDSPFSSSAEDTLSCPVTEVIAISHCGIKDSPVQSPNFQQTGSKLLSNVA   1121 - 1190
ASQPANISVFKRDLNVITSVPSELCLHEMSSDASLPGDPEAYPAAVSSGGAIHLQTGGGYFGLSFTCPSL   1191 - 1260
KNPISKKSWTRKLKSWAYRLRQSTSFFKRSKVRQVETEEMRSAIAPDPIPLTRESTADTRALNRCKAMSG   1261 - 1330
SFQRGRFQVITIPQQQSAKMTSFGIEHISVFSETNHSSEEAFIKTAKSQLVEIEPATQNPKTSFSYEKLQ   1331 - 1400
ALQETCKENKGVPKQGDNFLSFSAACETDVSSVTPEKEFEETSATGSSMQSGSELLLKEREILTAGKQPS   1401 - 1470
SDSEFSASLAGSGKSVAKTGPESNQCLPHHEEQAYAQTQSSLFYSPSSPMSSDDESEIEDEDLKVELQRL   1471 - 1540
REKHIQEVVNLQTQQNKELQELYERLRSIKDSKTQSTEIPLPPASPRRPRSFKSKLRSRPQSLTHVDNGI   1541 - 1610
VATGKSCLINELENPLCVESNAASCQQSPASKKGMFTDDLHKLVDDWTKEAVGNSLIKPSLNQLKQSQHK   1611 - 1680
LETENWNKVSENTPSTMGYTSTWISSLSQIRGAVPTSLPQGLSLPSFPGPLSSYGMPHVCQYNAVAGAGY   1681 - 1750
PVQWVGISGTTQQSVVIPAQSGGPFQPGMNMQAFPTSSVQNPATIPPGPK                       1751 - 1800
//

Text Mined References (35)

PMID Year Title
26069258 2015 Inhibition of WNK3 Kinase Signaling Reduces Brain Damage and Accelerates Neurological Recovery After Stroke.
24920754 2014 WNK3 abrogates the NEDD4-2-mediated inhibition of the renal Na+-Cl- cotransporter.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23838290 2013 KLHL2 interacts with and ubiquitinates WNK kinases.
23482566 2013 LINGO-1 receptor promotes neuronal apoptosis by inhibiting WNK3 kinase activity.
22864523 2012 Influence of WNK3 on intracellular chloride concentration and volume regulation in HEK293 cells.
21813709 2011 With-No-Lysine Kinase 3 (WNK3) stimulates glioma invasion by regulating cell volume.
21613606 2011 Similar effects of all WNK3 variants on SLC12 cotransporters.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20819979 2011 Altered expression of regulators of the cortical chloride transporters NKCC1 and KCC2 in schizophrenia.
More...