Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.24
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q9BYN8 Q96Q58 MRP-S26
Symbols GI008
MRPS13
RPMS13
MRP-S13
MRP-S26
NY-BR-87
C20orf193
dJ534B8.3

Gene

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (1)

AA Sequence

MLRALSRLGAGTPCRPRAPLVLPARGRKTRHDPLAKSKIERVNMPPAVDPAEFFVLMERYQHYRQTVRAL      1 - 70
RMEFVSEVQRKVHEARAGVLAERKALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQA     71 - 140
RKAEEVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS         141 - 205
//

Text Mined References (16)

PMID Year Title