Property Summary

NCBI Gene PubMed Count 38
PubMed Score 18.77
PubTator Score 52.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.7e-16

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 2.7e-16

Gene RIF (28)

AA Sequence

MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIR      1 - 70
EDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ        71 - 137
//

Text Mined References (44)

PMID Year Title