Property Summary

NCBI Gene PubMed Count 53
PubMed Score 39.38
PubTator Score 31.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
dermatomyositis 1.200 7.4e-03
glioblastoma 1.200 7.2e-03
group 3 medulloblastoma 1.100 4.6e-04
juvenile dermatomyositis 1.217 4.7e-12
Multiple myeloma 1.409 1.3e-04
osteosarcoma -1.111 5.1e-04
ovarian cancer 1.100 5.1e-03
posterior fossa group A ependymoma 1.100 4.3e-07
tuberculosis 1.400 2.0e-07
Waldenstrons macroglobulinemia 1.003 3.3e-03

 GO Component (2)

Protein-protein Interaction (2)

Gene RIF (23)

AA Sequence

MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVT      1 - 70
IWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNP     71 - 140
QELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTR    141 - 210
PGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPA    211 - 280
ECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDY    281 - 350
QRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLAL    351 - 420
RAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTS    421 - 490
GGCRCRVNGIPCHPSCQNCH                                                      491 - 510
//

Text Mined References (56)

PMID Year Title