Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRS      1 - 70
QRAASSRPIKLLQQPGTDTPQGRLYSDHYGLYHTSPSLGGLTRPVVLWSQQDVCKWLKKHCPHNYLVYVE     71 - 140
AFSQHAITGRALLRLNAEKLQRMGLAQEAQRQEVLQQVLRLQVREEGRSLQLLSQASFGKMS            141 - 202
//

Text Mined References (5)

PMID Year Title