Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.26
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.200 8.4e-03
glioblastoma 1.300 1.0e-02
intraductal papillary-mucinous carcinoma... 1.300 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.900 4.3e-03
Multiple myeloma 1.032 1.5e-03
osteosarcoma -1.855 2.8e-06
ovarian cancer 2.000 6.2e-05
psoriasis -1.300 1.3e-04

Gene RIF (2)

AA Sequence

MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSL      1 - 70
NEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQ     71 - 140
QTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSV    141 - 210
ALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPV    211 - 280
PKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNS    281 - 350
PGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR    351 - 420
LDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLR    421 - 490
HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ     491 - 559
//

Text Mined References (23)

PMID Year Title