Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.71
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.032 0.002
psoriasis -1.300 0.000
osteosarcoma -1.855 0.000
astrocytoma 1.200 0.008
glioblastoma 1.300 0.010
intraductal papillary-mucinous carcinoma... 1.300 0.004
intraductal papillary-mucinous neoplasm ... 1.900 0.004
ovarian cancer 2.000 0.000

Gene RIF (1)

PMID Text
26318451 binding affinities of the YTH domains of three human proteins and yeast YTH domain protein Pho92

AA Sequence

MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSL      1 - 70
NEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQ     71 - 140
QTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSV    141 - 210
ALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPV    211 - 280
PKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNS    281 - 350
PGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR    351 - 420
LDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLR    421 - 490
HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ     491 - 559
//

Text Mined References (20)

PMID Year Title
26593424 2015 5' UTR m(6)A Promotes Cap-Independent Translation.
26318451 2015 Structural Basis for the Discriminative Recognition of N6-Methyladenosine RNA by the Human YT521-B Homology Domain Family of Proteins.
26046440 2015 N(6)-methyladenosine Modulates Messenger RNA Translation Efficiency.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24284625 2014 N6-methyladenosine-dependent regulation of messenger RNA stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...