Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.22
PubTator Score 7.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 1.300 0.005
Amyotrophic Lateral Sclerosis 1.446 0.000
Atopic dermatitis -1.500 0.006
breast carcinoma -1.900 0.008
fibroadenoma -2.400 0.038
lung adenocarcinoma -3.200 0.000
adult high grade glioma 1.900 0.002
pilocytic astrocytoma 1.100 0.006
psoriasis -1.900 0.000
non-small cell lung carcinoma -1.200 0.000
ductal carcinoma in situ -2.300 0.007
invasive ductal carcinoma -3.000 0.003
type I diabetes mellitus -1.163 0.024

Gene RIF (3)

PMID Text
23333304 HIV-1 Vif downregulates the expression of fibroblast growth factor binding protein 2 (FGFBP2) in Vif-expression T cells
21079801 Results suggest that POLD2 and KSP37 might be potential prognostic biomarkers.
12322897 Secreted from NK cells in decidua, elevated at late gestational period.

AA Sequence

MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTY      1 - 70
WCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPN     71 - 140
QQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPF    141 - 210
QALCAFLISFFRG                                                             211 - 223
//

Text Mined References (9)

PMID Year Title
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
21079801 2010 POLD2 and KSP37 (FGFBP2) correlate strongly with histology, stage and outcome in ovarian carcinomas.
16652150 2006 Identification of expressed genes characterizing long-term survival in malignant glioma patients.
15898988 2005 Increase in killer-specific secretory protein of 37 kDa in bronchoalveolar lavage fluid of allergen-challenged patients with atopic asthma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12322897 2002 Accumulation of CD16+ cells with secretion of Ksp37 in decidua at the end of pregnancy.
11342666 2001 A novel serum protein that is selectively produced by cytotoxic lymphocytes.