Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.36
PubTator Score 7.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.900 2.0e-03
Amyotrophic lateral sclerosis 1.446 4.8e-05
Astrocytoma, Pilocytic 1.200 3.7e-03
Atopic dermatitis -1.500 5.6e-03
breast carcinoma -1.900 8.5e-03
ductal carcinoma in situ -2.300 7.1e-03
fibroadenoma -2.400 3.8e-02
glioblastoma 1.300 5.5e-03
invasive ductal carcinoma -3.000 2.5e-03
lung adenocarcinoma -1.500 7.0e-16
non-small cell lung carcinoma -1.200 7.1e-25
psoriasis -1.300 1.3e-13
type I diabetes mellitus -1.163 2.4e-02

Gene RIF (4)

AA Sequence

MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTY      1 - 70
WCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPN     71 - 140
QQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPF    141 - 210
QALCAFLISFFRG                                                             211 - 223
//

Text Mined References (10)

PMID Year Title