Property Summary

NCBI Gene PubMed Count 21
PubMed Score 9.49
PubTator Score 13.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

Gene RIF (7)

AA Sequence

MFTSEKGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQ      1 - 70
LLQFTLQFLPELIWCYLAVSASRNVHSSGCIEALLLGVYNLEIVDKQGHTKVLSFTIPSLSKPSVYHEPS     71 - 140
SIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRI    141 - 210
CVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEWDLAQKALDDIIYRAQLELYPEPLLVAN    211 - 280
AIKASLPHGPMKSNKEGTRCIQVEITPTSSRISRNAVTSMSIRGHRWKRHGNTELTGQEELMEISEVDEG    281 - 350
FYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGGKEKETTGESCKDHFARKQTQRAQSENLEL    351 - 420
LSLKRLTLTTSQSLPKPSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEK    421 - 490
LIYVSERTELPMKHQSGQQRPPSISITLSTD                                           491 - 521
//

Text Mined References (23)

PMID Year Title