Property Summary

NCBI Gene PubMed Count 31
Grant Count 8
R01 Count 7
Funding $2,467,206.8
PubMed Score 113.34
PubTator Score 61.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
26711529 These results indicate that the LPS/IL-1beta-MyD88 axis plays a crucial role for stabilization of IkappaB-zeta mRNA.
26398661 We propose a previously unappreciated role of IkappaBzeta in the inflammatory micromilieu as well as progression in glioma
25629767 NFKBIZ gene knockdown in bronchial epithelial cells suppresses the release of IL-1b-induced IL-6 and GMCSF.
25474109 Interferon-gamma (IFN-gamma) interferes with the IL-1/IKB-zeta axis in beta-glucan-activated dendritic cells and promotes T cell-mediated immune responses with increased release of IFN-gamma and IL-22.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta (NFKBIZ) in primary human brain microvascular endothelial cells
24027435 NF-kappaB-binding cofactor inhibitor of NF-kappaB-zeta (IkappaB-zeta) is constitutively expressed in HTLV-I-infected T cell lines and ATL cells, and Tax transactivates the IkappaB-zeta gene, mainly through NF-kappaB.
23898208 Microarray analysis indicates HIV-1 Tat-induced upregulation of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta (NFKBIZ) in primary human brain microvascular endothelial cells
23869088 our data demonstrate that IkappaB-zeta is essential for nuclear NF-kappaB activity in activated B-cell-like subtype of diffuse large B-cell lymphoma
22059479 investigation of signaling components that induce activation of post-transcriptional mechanism for IkappaB-zeta induction/activation: Activation of IRAK1 or IRAK4, but not TRAF6, is sufficient.
21224476 IkappaBzeta functions as an important regulator of IFN-gamma in human NK cells
More...

AA Sequence

MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAPGSPGSDSSDF      1 - 70
SSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSVKELLLHIRSHKQKASGQAVD     71 - 140
DFKTQGVNIEQFRELKNTVSYSGKRKGPDSLSDGPACKRPALLHSQFLTPPQTPTPGESMEDVHLNEPKQ    141 - 210
ESSADLLQNIINIKNECSPVSLNTVQVSWLNPVVVPQSSPAEQCQDFHGGQVFSPPQKCQPFQVRGSQQM    211 - 280
IDQASLYQYSPQNQHVEQQPHYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRES    281 - 350
ENIANPMQTSSSVQQQNDAHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQW    351 - 420
QVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAA    421 - 490
NQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAV    491 - 560
IAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIR    561 - 630
LFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGE    631 - 700
QIRRILKGKSIQQRAPPY                                                        701 - 718
//

Text Mined References (33)

PMID Year Title
26711529 2016 Screening of posttranscriptional regulatory molecules of I?B-?.
26398661 2015 I?B?, an atypical member of the inhibitor of nuclear factor kappa B family, is induced by ?-irradiation in glioma cells, regulating cytokine secretion and associated with poor prognosis.
25629767 2015 House Dust Mite Allergens and the Induction of Monocyte Interleukin 1? Production That Triggers an I?B?-Dependent Granulocyte Macrophage Colony-Stimulating Factor Release from Human Lung Epithelial Cells.
25474109 2014 Interleukin-1 and interferon-? orchestrate ?-glucan-activated human dendritic cell programming via I?B-? modulation.
25107474 2014 Akirin2 is critical for inducing inflammatory genes by bridging I?B-? and the SWI/SNF complex.
24027435 2013 Human T cell leukemia virus type I tax-induced I?B-? modulates tax-dependent and tax-independent gene expression in T cells.
23869088 2013 I?B-? controls the constitutive NF-?B target gene network and survival of ABC DLBCL.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22059479 2012 Identification of interleukin-1 receptor-associated kinase 1 as a critical component that induces post-transcriptional activation of I?B-?.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
More...