Property Summary

NCBI Gene PubMed Count 35
PubMed Score 143.15
PubTator Score 61.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.586 3.4e-02
acute myeloid leukemia 1.200 3.2e-02
acute quadriplegic myopathy 1.056 8.5e-03
adrenocortical carcinoma -1.607 1.1e-02
Astrocytoma, Pilocytic 1.300 5.0e-04
atypical teratoid/rhabdoid tumor -1.200 2.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.316 1.4e-02
cystic fibrosis 1.094 1.7e-02
glioblastoma 1.600 1.5e-03
interstitial cystitis 1.200 5.1e-03
juvenile dermatomyositis 1.166 5.1e-06
lung carcinoma -3.300 1.0e-25
medulloblastoma, large-cell -1.200 1.6e-02
non-small cell lung cancer -1.825 5.9e-11
osteosarcoma 3.155 8.7e-06
ovarian cancer -2.300 2.3e-09
pancreatic cancer 2.100 4.6e-04
pituitary cancer -2.400 2.5e-04
posterior fossa group A ependymoma 1.100 6.3e-04
primary pancreatic ductal adenocarcinoma 1.335 1.0e-02
psoriasis 1.700 2.7e-25
Rheumatoid arthritis 2.800 1.5e-04
sonic hedgehog group medulloblastoma -1.100 2.4e-02
spina bifida -1.709 3.9e-02
subependymal giant cell astrocytoma 2.650 9.0e-03
ulcerative colitis 2.300 4.1e-07

Gene RIF (28)

AA Sequence

MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAPGSPGSDSSDF      1 - 70
SSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSVKELLLHIRSHKQKASGQAVD     71 - 140
DFKTQGVNIEQFRELKNTVSYSGKRKGPDSLSDGPACKRPALLHSQFLTPPQTPTPGESMEDVHLNEPKQ    141 - 210
ESSADLLQNIINIKNECSPVSLNTVQVSWLNPVVVPQSSPAEQCQDFHGGQVFSPPQKCQPFQVRGSQQM    211 - 280
IDQASLYQYSPQNQHVEQQPHYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRES    281 - 350
ENIANPMQTSSSVQQQNDAHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQW    351 - 420
QVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAA    421 - 490
NQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAV    491 - 560
IAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIR    561 - 630
LFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGE    631 - 700
QIRRILKGKSIQQRAPPY                                                        701 - 718
//

Text Mined References (37)

PMID Year Title