Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.90
PubTator Score 8.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 2.8e-03
atypical teratoid / rhabdoid tumor -2.700 4.7e-05
ependymoma -2.200 1.0e-05
glioblastoma -1.200 2.0e-02
group 3 medulloblastoma 1.400 5.6e-04
lung cancer 3.800 7.6e-06
lung carcinoma 3.800 1.6e-42
medulloblastoma, large-cell 1.200 3.1e-04
oligodendroglioma 1.700 1.3e-02
osteosarcoma 1.299 1.2e-04
Pick disease -1.700 8.9e-04
pituitary cancer 3.800 4.2e-08
primitive neuroectodermal tumor -1.300 1.2e-02
psoriasis -1.400 1.0e-02
subependymal giant cell astrocytoma -2.763 1.3e-02

Gene RIF (11)

AA Sequence

MPAARPPAAGLRGISLFLALLLGSPAAALERDALPEGDASPLGPYLLPSGAPERGSPGKEHPEERVVTAP      1 - 70
PSSSQSAEVLGELVLDGTAPSAHHDIPALSPLLPEEARPKHALPPKKKLPSLKQVNSARKQLRPKATSAA     71 - 140
TVQRAGSQPASQGLDLLSSSTEKPGPPGDPDPIVASEEASEVPLWLDRKESAVPTTPAPLQISPFTSQPY    141 - 210
VAHTLPQRPEPGEPGPDMAQEAPQEDTSPMALMDKGENELTGSASEESQETTTSTIITTTVITTEQAPAL    211 - 280
CSVSFSNPEGYIDSSDYPLLPLNNFLECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVLAN    281 - 350
QTLLVEGQVIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPRRPDSGDVTVMDLHSGGVAHFHCH    351 - 420
LGYELQGAKMLTCINASKPHWSSQEPICSAPCGGAVHNATIGRVLSPSYPENTNGSQFCIWTIEAPEGQK    421 - 490
LHLHFERLLLHDKDRMTVHSGQTNKSALLYDSLQTESVPFEGLLSEGNTIRIEFTSDQARAASTFNIRFE    491 - 560
AFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFTCDPGHSLEQGPAIIECINVRDPYWNDTEPLCRAMCGG    561 - 630
ELSAVAGVVLSPNWPEPYVEGEDCIWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGN    631 - 700
SGPQKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARIT    701 - 770
YQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVL    771 - 840
EGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFELMGE    841 - 910
VTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAEAAAETSLEGGNMALAIFIPVLIISLLLGGAYIYIT    911 - 980
RCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI                              981 - 1024
//

Text Mined References (22)

PMID Year Title