Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.26
PubTator Score 2.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.3e-24
non-small cell lung carcinoma 317 6.7e-17
lung adenocarcinoma 2716 2.3e-06
osteosarcoma 7950 8.8e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.500 2.3e-06
non-small cell lung carcinoma 1.800 6.7e-17
osteosarcoma 1.216 8.8e-06
psoriasis 1.100 1.3e-24

Gene RIF (2)

AA Sequence

MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSS      1 - 70
SVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDP     71 - 140
EPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKG    141 - 210
MVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLK    211 - 280
PELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLR    281 - 350
DRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEK    351 - 420
RILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKM    421 - 490
PLSALYGTLSLLQQLAEA                                                        491 - 508
//

Text Mined References (17)

PMID Year Title