Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $118,665.16
PubMed Score 2.72
PubTator Score 2.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.216 0.000
lung adenocarcinoma 1.700 0.000
psoriasis 1.400 0.000
non-small cell lung carcinoma 1.800 0.000

Synonym

Accession Q9BYG8 Q5XKF3 Q6P494
Symbols MLZE

Gene

 Grant Application (2)

Gene RIF (1)

PMID Text
19051310 Study investigated the expression pattern of the GSDM family genes in the upper gastrointestinal epithelium and cancers.

AA Sequence

MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSS      1 - 70
SVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDP     71 - 140
EPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKG    141 - 210
MVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLK    211 - 280
PELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLR    281 - 350
DRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEK    351 - 420
RILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKM    421 - 490
PLSALYGTLSLLQQLAEA                                                        491 - 508
//

Text Mined References (16)

PMID Year Title
27281216 2016 Pore-forming activity and structural autoinhibition of the gasdermin family.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
23393555 2013 Genome-wide association study of retinopathy in individuals without diabetes.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19270707 2009 Key susceptibility locus for nonsyndromic cleft lip with or without cleft palate on chromosome 8q24.
19051310 2009 Distinctive expression and function of four GSDM family genes (GSDMA-D) in normal and malignant upper gastrointestinal epithelium.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...