Property Summary

NCBI Gene PubMed Count 7
Grant Count 4
Funding $585,567.5
PubMed Score 130.29
PubTator Score 14.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
12889070 The sequence and function of the related mouse gene are described.

AA Sequence

MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSKVSWKLRFQKREPLKNVFFILAERARDPSAKKRHMAMR      1 - 70
NLGTMAYEAPDKVRKYKKIVLDLLVYGLYDPVNLEVIHESMKTLTVVLGKIQGKGLGSFFIDITLQTRTL     71 - 140
LDDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRDSLLIHLQDRNPQVAKACKTTFQACSPYLKL    141 - 210
KEEYSFQSEEDQRNTKLYQQLSHYHPEILQFFYANKIL                                    211 - 248
//

Text Mined References (8)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12889070 2003 Candidate testis-determining gene, Maestro (Mro), encodes a novel HEAT repeat protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401430 2001 Physical and transcriptional map of a 311-kb segment of chromosome 18q21, a candidate lung tumor suppressor locus.