Property Summary

NCBI Gene PubMed Count 26
PubMed Score 5.86
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q9BYG5 A2A2A7 Q9Y510 PAR-6 beta
Symbols PAR6B

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
26526116 found that the polarity determinants Cdc42, Par6B, PKCzeta/iota and the structural proteins ezrin and phospho-ezrin were lost from the apical membrane and accumulated either in the cytoplasm or on the basal side of enterocytes in patients
25662318 PAK4 phosphorylates Par6B at Ser143 blocking its interaction with Cdc42.
21300793 Data conclude that Par6B and aPKC control mitotic spindle orientation in polarized epithelia and, furthermore, that aPKC coordinately regulates multiple processes to promote morphogenesis.
20631255 This study demonstrates that controlled regulation of PAK4 is required for apical junction formation in lung epithelial cells and highlights potential cross-talk between two Cdc42 targets, PAK4 and Par6B.
19401335 Interaction between PAR-3 and the aPKC-PAR-6 complex is indispensable for apical domain development of epithelial cells.
15677324 The ability of SRC family coactivators to regulate the expression of one of these genes, PARD6B/Par6, was confirmed by using cells individually depleted of SRC-1.

AA Sequence

MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL      1 - 70
PINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFR     71 - 140
PVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLA    141 - 210
VNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQI    211 - 280
EPSFEPEDEDSEEDDIIIEDNGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSN    281 - 350
TEFETHAPDQKLLEEDGTIITL                                                    351 - 372
//

Text Mined References (28)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26526116 2016 The localisation of the apical Par/Cdc42 polarity module is specifically affected in microvillus inclusion disease.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25662318 2015 Functional cross-talk between Cdc42 and two downstream targets, Par6B and PAK4.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21771265 2011 Genome-wide association study on bipolar disorder in the Bulgarian population.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21300793 2011 Par6B and atypical PKC regulate mitotic spindle orientation during epithelial morphogenesis.
More...