Property Summary

NCBI Gene PubMed Count 26
PubMed Score 6.28
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.800 5.4e-03
breast carcinoma 2.100 7.7e-05
ductal carcinoma in situ 1.400 2.1e-02
interstitial cystitis -1.600 6.6e-03
interstitial lung disease -2.000 5.9e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.3e-02
invasive ductal carcinoma 2.100 4.6e-02
lung cancer -2.100 5.8e-03
lung carcinoma -1.400 7.1e-22
non-small cell lung cancer -1.838 1.2e-16
ovarian cancer -1.100 5.0e-03
pancreatic cancer 1.100 1.3e-04
posterior fossa group B ependymoma 1.300 1.3e-03

 GWAS Trait (1)

Protein-protein Interaction (12)

Gene RIF (6)

AA Sequence

MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL      1 - 70
PINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFR     71 - 140
PVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLA    141 - 210
VNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQI    211 - 280
EPSFEPEDEDSEEDDIIIEDNGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSN    281 - 350
TEFETHAPDQKLLEEDGTIITL                                                    351 - 372
//

Text Mined References (28)

PMID Year Title