Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.62
PubTator Score 2.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 4.1e-07
atypical teratoid / rhabdoid tumor 1.300 3.6e-06
cystic fibrosis 1.318 1.0e-04
ependymoma 1.100 3.4e-08
glioblastoma 1.100 1.5e-06
group 3 medulloblastoma 1.700 6.7e-05
interstitial cystitis -1.400 4.4e-04
medulloblastoma, large-cell 1.300 1.4e-02
non-small cell lung cancer 1.286 1.2e-08
osteosarcoma 1.026 4.3e-02
primitive neuroectodermal tumor 1.700 3.4e-05
tuberculosis -1.500 1.7e-04

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYKLVVHTHHISNSDVTIGYADVHGD      1 - 70
LLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRAHLDIGLPRDF     71 - 140
RPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLL    141 - 210
AVNDEVLEVNGIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPP    211 - 280
APRVLQNFHPDEAESDEDNDVVIEGTLEPARPPQTPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLS    281 - 350
SLRADPRHSLALPPGGVEEHGPAVTL                                                351 - 376
//

Text Mined References (14)

PMID Year Title