Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.62
PubTator Score 2.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q9BYG4 A8QM57 PAR-6 gamma
Symbols PAR-6G
PAR6gamma

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
26073086 This paper shows Par6G as a negative regulator of the phosphatidylinositol 3'-kinase/phosphoinositide-dependent protein kinase 1/Akt pathway and epithelial cell proliferation and evidence for frequent inactivation of Par6G gene in epithelial cancers.
23333304 HIV-1 Vif modulates the expression of par-6 family cell polarity regulator gamma (PARD6G) in Vif-expression T cells
23264737 this study is the first to identify Par6gamma as a component of the mother centriole and to report a role of a mother centriole protein in the regulation of centrosomal protein composition.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYKLVVHTHHISNSDVTIGYADVHGD      1 - 70
LLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRAHLDIGLPRDF     71 - 140
RPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLL    141 - 210
AVNDEVLEVNGIEVAGKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPP    211 - 280
APRVLQNFHPDEAESDEDNDVVIEGTLEPARPPQTPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLS    281 - 350
SLRADPRHSLALPPGGVEEHGPAVTL                                                351 - 376
//

Text Mined References (14)

PMID Year Title
26073086 2016 Par6G suppresses cell proliferation and is targeted by loss-of-function mutations in multiple cancers.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
23264737 2013 Par6? is at the mother centriole and controls centrosomal protein composition through a Par6?-dependent pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17057644 2006 A distinct PAR complex associates physically with VE-cadherin in vertebrate endothelial cells.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...